Support




Contact
Ace:
aceofspadeshq at gee mail.com
CBD:
cbd.aoshq at gee mail.com
Buck:
buck.throckmorton at protonmail.com
joe mannix:
mannix2024 at proton.me
MisHum:
petmorons at gee mail.com
J.J. Sefton:
sefton at cutjibnewsletter.com
Powered by
Movable Type





John-Paul Nungesser, Accused of Rape and Harassed by "Mattress Project," Sues Columbia For Enabling the Harassment

This man has been defamed and harassed for years-- all with the enabling of Columbia University, and Senator Kirsten Gillibrand.

Paul Nungesser was found "not responsible" for sexually assaulting another student at Columbia University. The student who accused him, Emma Sulkowicz, has since began carrying a mattress around the university as part of an art project to protest a finding she claims was unfair.

Sulkowicz’s activism earned her an invitation to President Obama’s State of the Union address Tuesday night from Sen. Kirsten Gillibrand, D-N.Y. When Nungesser heard of the invitation, he blasted the senator for rewarding Sulkowicz’s attacks against him.

"I am shocked to learn that Sen. Gillibrand is actively supporting Ms. Sulkowicz's defamation campaign against me by providing her with a public forum in which to broadcast her grave allegation," Nungesser told New York Magazine on Tuesday. "By doing so, Sen. Gillibrand is participating in a harassment campaign against someone, who, for good reason, has been found innocent by all investigating bodies."

Sulkowicz was permitted by Columbia to carry around a mattress to further defame Nungesser, and even make her carrying around of that mattress her senior art project -- for college credit.

Note that Nungesser has been cleared multiple times of the claims Emma Sulkowicz has made against him -- and the charges that Sulkowicz induced two other women to file against him, in a sort of warped solidarity.

And Sulkowicz also tried to bring charges with the NYPD -- who also refused to prosecute.

But throughout this, Sulkowicz has spoken to the media -- violating Columbia's confidentiality rules -- and made it easy to determine who she was accusing.

However, Nungesser himself has not spoken to the media much, until recently.

He was bound by confidentiality, whereas Sulkowicz paraded around that mattress, claiming he'd raped her.

Well, now he's filed a lawsuit which contains all the details confidentiality rules previously blockaded him from releasing.

Robby Soave correctly calls the texts published in the lawsuit what they are -- damning.

I strongly encourage everyone to read the lawsuit. It is filled with damning claims. And believe me, it is not slow reading.

Assuming these texts are real -- and I can't see them likely being fake, as they'll be subject to scrutiny by the courts, and more than likely have been looked at by Colubia and the police -- then Columbia better put aside money for a Rolling Stone-level settlement.

I just don't see how a "rape victim" could possibly text her "rapist" things like "I love youyouyou" after the "rape."

But we'll probably be told that rape victims do this all the time, just like we were told in the case of Jackie that rape victims always changed their stories and appeared deceptive and evasive.

Posted by: Ace at 06:12 PM




Comments

(Jump to bottom of comments)

1 Firsties?

Posted by: Albert Schweitzer at April 24, 2015 06:13 PM (xkSSa)

2 I hope he is suing her as well as Columbia.

Posted by: Vic We Have No Party at April 24, 2015 06:14 PM (wlDny)

3 3rd!

Posted by: OregonMuse at April 24, 2015 06:15 PM (I8YZX)

4 I'm being assaulted on collage campuses constantly.

Posted by: "Blind" Justice statue at April 24, 2015 06:15 PM (Lqb+9)

5 You said 'I love you' twice.

I like rape.

Posted by: GnuBreed at April 24, 2015 06:15 PM (rlAIa)

6 You know all of this is actually due to Global Warming, right?!?

Posted by: Neil Disgrace Tyson at April 24, 2015 06:15 PM (ihXSm)

7 If she was carrying a mattress she was practically begging for it.

Posted by: Garrett at April 24, 2015 06:16 PM (9cwxE)

8 Good for him.

Posted by: HH at April 24, 2015 06:16 PM (Ce4DF)

9 I mean, it had satin sheets on it.

Satin. Sheets.

Posted by: Garrett at April 24, 2015 06:17 PM (9cwxE)

10 Ha! Love to start my weekend with a little blowback against the leftards. Now we will savor their sweet, sweet whining. Thanks, ace!

Posted by: OregonMuse at April 24, 2015 06:17 PM (I8YZX)

11 Sulkowicz was permitted by Columbia to carry around a mattress to
further defame Nungesser, and even make her carrying around of that
mattress her senior art project -- for college credit.

Ahhhh...I think I've found the problem.

Posted by: tu3031 at April 24, 2015 06:17 PM (YFFpo)

12 Ummm... Sally Field? Debbie Reynolds? Is it Agnes Gonxha Bojaxhiu?

Posted by: Ron-Paul Nunguesser at April 24, 2015 06:17 PM (xkSSa)

13 Mattresses are actually very comfortable attire.

Posted by: Sandra Flook at April 24, 2015 06:17 PM (Dwehj)

14
Wouldn't it be more effective if they lugged around a pinball machine?

Posted by: Soothsayer, Inc. -- The King Unwilling at April 24, 2015 06:18 PM (Tk6Z0)

15 Let me guess, the rape claims started when he dumped her?

Posted by: Lauren at April 24, 2015 06:18 PM (ZLNps)

16 "This suit is like we are being raped. So we are the real victims here, yeah that is the ticket."

Posted by: Columbia University at April 24, 2015 06:18 PM (Lqb+9)

17 If she was carrying a mattress she was practically begging for it.

Based on the texts, she literally was begging for it. And didn't get it.

This whole sorry episode is an object lesson in keeping clear separation between Dick and Crazy.

Posted by: boulder terlit hobo at April 24, 2015 06:18 PM (AVEe1)

18
That's where most rapes take place, right, on a pinball machine?

Posted by: Soothsayer, Inc. -- The King Unwilling at April 24, 2015 06:18 PM (Tk6Z0)

19 Heh. I didn't need no stinking mattress to land that interview.

Posted by: Jackie at April 24, 2015 06:19 PM (xkSSa)

20 19

Posted by: 19 at April 24, 2015 06:19 PM (6E2VN)

21 Ah yes, Columbia University -- The school where TFG, aka The Ghost Of Columbia U., went (supposedly).

Posted by: GnuBreed at April 24, 2015 06:19 PM (rlAIa)

22 This John-Paul Nungesser doesn't know how to stay in his place and keep his mouth. Maybe he needs a visit.

Posted by: Wisconsin Prosecutors at April 24, 2015 06:19 PM (Q/rld)

23 she's pretty much made herself unemployable except for government or academia.

Posted by: X at April 24, 2015 06:19 PM (n5fTN)

24 You know...the woman in the mattress ads here is kinda hawt.

Posted by: Diogenes at April 24, 2015 06:19 PM (08Znv)

25 Dammit

Posted by: 23? at April 24, 2015 06:19 PM (6E2VN)

26 Forget it. Now to read the essay.

Posted by: 27 at April 24, 2015 06:19 PM (6E2VN)

27
So, why didnt the woman file a civil suit if she felt so aggrieved? Because no atty wd take it pro bono and she didnt have the money to pay? The photos of her carting that mattress around make her look like a nut or a hooker or a nutty hooker.

Posted by: Bruce J. at April 24, 2015 06:20 PM (iQIUe)

28 Tonight, we go to the mattresses.

Posted by: Zombie Clemenza at April 24, 2015 06:20 PM (Dwehj)

29 This whole sorry episode is an object lesson in keeping clear separation between Dick and Crazy.
Posted by: boulder terlit hobo at April 24, 2015 06:18 PM (AVEe1)

We saw how you looked at us, with those rapey eyes. You should be punished for that.

Posted by: Special snowflakes at April 24, 2015 06:21 PM (Lqb+9)

30 she's pretty much made herself unemployable except for government or academia.

So you're saying she'll be wealthy when she retires, then.

Posted by: OregonMuse at April 24, 2015 06:21 PM (I8YZX)

31 Posted by: 27 at April 24, 2015 06:19 PM (6E2VN)



Boy howdy, you just can't win, eh?

Posted by: HH at April 24, 2015 06:21 PM (Ce4DF)

32 Young Men (including my own boy) ...


... before you get involved AT ANY LEVEL with a girl, you damn well better know her politics. If she's a Progressive, stay the hell away.


That's where we're at. And for those of you with these Progressive "friends and family", you are completely bullshitting yourselves if you think they will it turn on you.


It is a Time of Choosing.

Posted by: ScoggDog at April 24, 2015 06:21 PM (GWm7j)

33 Pinball machines and Glass Coffee Tables are the two leading causes of rape.

Posted by: Garrett at April 24, 2015 06:22 PM (9cwxE)

34 Casper the friendly mattress.

Posted by: Bertram Cabot Jr. at April 24, 2015 06:22 PM (W5DcG)

35 >>>15 Let me guess, the rape claims started when he dumped her?

that's what he claims, that she got more and more lovey-dovey and when he did not reciprocate, she started claiming rape.

I didn't mention this but an early facebook message from her says "fuck me in the butt." (She would ultimately allege an anal rape.)

He also says she's accused other people of sexual assault, including an ex-boyfriend.

It's just filled with a lot of stuff that makes you think her claims are not credible.

Posted by: ace at April 24, 2015 06:22 PM (PA7DS)

36
HOW WOULD YOU LIKE TO LOSE WEIGHT AND LOOK GREAT?

Posted by: an annoying tv commerical break at April 24, 2015 06:22 PM (Tk6Z0)

37 hey columbia, this is the part where you take it in the ass. and just like her, you asked for it.

Posted by: X at April 24, 2015 06:22 PM (n5fTN)

38 You guys are missing the Big Picture.

Nunngesser is going to be *swimming* in p***y because of this. The man is going to get laid more than the tiles at the Al Hambra.

He was so good in bed that he drove a woman insane? Chicks dig guys who drive chicks insane. It's science.

Nunngesser should still sue the shit out of Columbia and Gillibrand and Sulckowicz ... but he'll be dining out on this for the rest of his years. If you know what I mean.

Posted by: BumperStickerist at April 24, 2015 06:23 PM (0MJOU)

39 Rape feels weird on a Friday afternoon.

Posted by: Garrett at April 24, 2015 06:23 PM (9cwxE)

40 Unfortunately, Gillibrand, as an elected official, can't be sued for her slanderous and defamatory remarks.

Posted by: OregonMuse at April 24, 2015 06:23 PM (I8YZX)

41
"Paul had grabbed her at a party and tried to kiss her."

He said this never happened. But assuming it did, if this is criminal conduct as a species we are screwed.

Posted by: Bruce J. at April 24, 2015 06:24 PM (iQIUe)

42 I didn't mention this but an early facebook message from her says "fuck me in the butt." (She would ultimately allege an anal rape.)

Whut. Whut?

Posted by: boulder terlit hobo at April 24, 2015 06:24 PM (AVEe1)

43 Note to all men out there: stay away from the crazy.

Stay.

Away.

Posted by: shibumi who is exceptionally cynical today at April 24, 2015 06:24 PM (1uKzc)

44 there's a part in her text where she's talking about having sex not just with her boyfriend (a John Doe, not part of the suit) but with *all* of his friends, often while drunk.

That might be what Nungesser means by "making allegations against other people," actually.

I think you have to read this lawsuit *very* carefully to pick up on what IS and IS NOT evidenced.

the lawsuit is very convincing-- until you kick the tires in it.

Not that I'm saying I don't believe him, just that the lawsuit (like the "jackie" story at rolling stone) makes you think there's more evidence for things than there really is.

Posted by: ace at April 24, 2015 06:25 PM (PA7DS)

45 >>didn't mention this but an early facebook message from her says "fuck me in the butt."


This is what wrecked...um, her case.

Posted by: Garrett at April 24, 2015 06:25 PM (9cwxE)

46 Whoa. Looney Tunes, babe.

Posted by: Jay Guevara at April 24, 2015 06:26 PM (oKE6c)

47 >>>Rape feels weird on a Friday afternoon.

i'm sure it must be 11 pm *some*where in the world!

Posted by: ace at April 24, 2015 06:26 PM (PA7DS)

48 Sulkowicz was permitted by Columbia to carry around a mattress to further defame Nungesser, and even make her carrying around of that mattress her senior art project -- for college credit.

Things to get rid of in higher education:
1. Humanities
2. Social Sciences
3. Art

Well, I guess art instruction is valuable but if they're letting this kind of crap count, might as well scrap the whole thing.

Posted by: AnnaDude at April 24, 2015 06:27 PM (b4b5c)

49
45 >>didn't mention this but an early facebook message from her says "fuck me in the butt."

This is what wrecked...um, her case.

Posted by: Garrett at April 24, 2015 06:25 PM (9cwxE)

*************************************************

What is this fellows phone number? Asking for a friend.

Posted by: Barney Frank at April 24, 2015 06:27 PM (xkSSa)

50 He should join that scrunt Gillibrandt to the suit

Posted by: Anti-socialist at April 24, 2015 06:27 PM (+kznc)

51 there's a part in her text where she's talking about having sex not just
with her boyfriend (a John Doe, not part of the suit) but with *all* of
his friends, often while drunk.




So John Doe and all the other soldiers in the army that marched between her legs are wiping their brows and saying, "Phew! That was close!"

Posted by: Jay Guevara at April 24, 2015 06:28 PM (oKE6c)

52 I'm just saying. All this rape will have me waking up tomorrow morning and thinking it's Wednesday.

Posted by: Garrett at April 24, 2015 06:28 PM (9cwxE)

53 As an alum, I've got to say that this chick is lowering the standards of our alma mater when it comes to carrying around phony grievances.

Posted by: Barack Obama, invisible Columbia student at April 24, 2015 06:28 PM (nFdGS)

54 The transcript makes one feel like a voyeur. I stopped reading in disgust. I think it was the butt fucking.

If this is an example of university life, no wonder people are without direction or anchor. Good luck to 'Merica.

Posted by: just bob at April 24, 2015 06:29 PM (wkuqO)

55 If she had put that mattress to good use she could afford an attorney for a civil suit.

Posted by: Hank at April 24, 2015 06:29 PM (K+1ie)

56 Posted by: ace at April 24, 2015 06:25 PM (PA7DS)

Well, as you wrote, the texts will be examined for accuracy. It would seem counterproductive to include those texts if they can't be substantiated.

Although that part is described as "messaged," whatever that means.

Posted by: CharlieBrown'sDildo at April 24, 2015 06:30 PM (Zu3d9)

57 We are pleased to announce we will have a new weekend show, To The Mattresses with Emma Sulkowicz.

Posted by: MSNBC at April 24, 2015 06:30 PM (Q/rld)

58 She texted him asking for Teh Butt Secks. Not that there's anything wrong with that...

Posted by: Afroman at April 24, 2015 06:30 PM (uTc5j)

59
I really dont understand this running to the school dean instead of the cops to report an assault. That's what the Lena chick did. Not sure is this one did, too.

Posted by: Bruce J. at April 24, 2015 06:31 PM (iQIUe)

60 11 pm? I thought rape was an after midnight thing?

Posted by: Garrett at April 24, 2015 06:31 PM (9cwxE)

61 You mails here should for once be forced to walk a mile with someone else's mattress on YOUR back.

Posted by: Sal E. Cone at April 24, 2015 06:31 PM (x6d4B)

62 Bitches be crazy, yo.

Posted by: Pappy O'Daniel at April 24, 2015 06:32 PM (YvRAm)

63 No, my progressive friends and family won't turn it on me. My progressive "family" is one person who lives thousands of miles away. My progressive friends will not accuse me of rape and since they're rather less progressive than absolute leftist loons. and also Christians I'm not worried about them.

Posted by: FenelonSpoke at April 24, 2015 06:32 PM (DXzRD)

64 Key text message quote to John- Paul from an early page in the lawsuit:

Emma: fuck me in the butt

That sounds very rapey, don't it?

Posted by: GnuBreed at April 24, 2015 06:32 PM (rlAIa)

65
his gay name alone shoulda cleared him, no?

Posted by: an annoying tv commerical break at April 24, 2015 06:33 PM (Tk6Z0)

66
The male students threatening him are nuts, too. Has every guy been neutered?

Posted by: Bruce J. at April 24, 2015 06:33 PM (iQIUe)

67 Good for Him!
She should have never been allowed to do her mattress shtick.

Posted by: Lizzy at April 24, 2015 06:33 PM (2TN4k)

68 Is he as hot as RYAN??

Posted by: Jackie at April 24, 2015 06:33 PM (YvRAm)

69 40
Unfortunately, Gillibrand, as an elected official, can't be sued for her slanderous and defamatory remarks.


Posted by: OregonMuse at April 24, 2015 06:23 PM (I8YZX)


Depends on where and why she made her comments. She can't be sued if she said it on the floor of the Senate as part of debate or a hearing. But otherwise he can sue away.

Posted by: Vic We Have No Party at April 24, 2015 06:34 PM (wlDny)

70 Hope he's claiming that her behavior made the entire campus an "unsafe" space. Drag Title IX into it.

Posted by: Lizzy at April 24, 2015 06:34 PM (2TN4k)

71 If she was carrying a mattress she was practically begging for it.

Posted by: Garrett


I call an early threadwinner!

Posted by: Oedipus at April 24, 2015 06:34 PM (CXLVd)

72 You mails here should for once be forced to walk a mile with someone else's mattress on YOUR back.
Posted by: Sal E. Cone

That gives me a great idea for an ROTC activity.

Posted by: Gen Peggy Combs at April 24, 2015 06:34 PM (Q/rld)

73 If she simply had yelled at him for a month or so every time she saw him, and called him terrible names to her friends, she'd have been suspended. Maybe vilified on the internet. Instead, she's famous and got invited to the State of the Union.

So I think she took the right path with this whole mattress thing.

Posted by: Britt McHenry at April 24, 2015 06:34 PM (FCsIb)

74 The male students threatening him are nuts, too. Has every guy been neutered?

Posted by: Bruce J. at April 24, 2015 06:33 PM



It's all the soy.

Posted by: huerfano at April 24, 2015 06:34 PM (bynk/)

75 Where's AtC?

She'd have a field day.

Posted by: Golfman at April 24, 2015 06:34 PM (48QDY)

76 That Sulkowicz girl?? She likes anal sex. Boy howdy does she like it in the tail pipe.

Posted by: BuckIV at April 24, 2015 06:35 PM (CLfqv)

77 Posted by: ace at April 24, 2015 06:22 PM (PA7DS)

Yeah, there was a part in her story in which she talks about waking up and he was gone.

It struck me that this was his real crime and she was self-aware enough that this wouldn't be persuasive but Freud always slips.

Posted by: AmishDude at April 24, 2015 06:35 PM (b4b5c)

78 Poor guy. If only he'd had access to some ONTs to be warned about having not sex with crazy gurls.

Posted by: PaleRider at April 24, 2015 06:35 PM (dkExz)

79 I think I'll skip reading the lawsuit and wait for the porn parody version to come out. From the look of things, Miss Sulkowicz might have the opportunity to portray herself.

Posted by: Emmet Milbarge at April 24, 2015 06:35 PM (nFdGS)

80 And I see ace beat to it in mentioning that butt quote.

Posted by: GnuBreed at April 24, 2015 06:35 PM (rlAIa)

81 who bitch this is?

Posted by: X at April 24, 2015 06:36 PM (n5fTN)

82 71: Seconded. The motion passes. The meeting is adjourned. The bar is open.

Posted by: Manolo at April 24, 2015 06:36 PM (NCVM7)

83 Did someone say anal sex?

Posted by: AstroGlide Man at April 24, 2015 06:36 PM (uTc5j)

84 >>Nunngesser is going to be *swimming* in p***y because of this. The man
is going to get laid more than the tiles at the Al Hambra.



I would think he would be extra choosey given that his accuser may have inspired other crazy chicks to accuse him of rape.

Posted by: Lizzy at April 24, 2015 06:36 PM (2TN4k)

85 There needs to be a warning label affixed to her that reads "Bat Shit Crazy, do not touch or get within facial recognition range" to warn males.

I hope his lawsuit includes her and that all she's left with is that mattress.

Posted by: Gmac- Pulling in feelers in preperation... at April 24, 2015 06:36 PM (4CRfK)

86
DO YOU WAKE UP FEELING TIRED? DO YOU WANT TO SLEEP BETTER?

Posted by: an annoying tv commerical break at April 24, 2015 06:36 PM (Tk6Z0)

87 errr not having sex. stepping away from the keyboard for a bit now.

Posted by: PaleRider at April 24, 2015 06:37 PM (dkExz)

88 >>Yeah, there was a part in her story in which she talks about waking up and he was gone.


So, this guy have her the Kaiser Soze and she lost it?

Posted by: Garrett at April 24, 2015 06:37 PM (9cwxE)

89 Lee Bollinger, President of Columbia, and white male quisling extraordinaire, also engineered the perversion of justice that was the affirmative action cases at the University of Michigan. He spent tens of millions of tax dollars and tuition dollars defending a discrimination regime that was eventually struck down by Michigan voters. He then spent millions more trying to overthrow the will of the voters only to have the Supreme Court strike THAT down.

Somewhere in the middle of all that, he boogied to Columbia, no doubt in the hope he could continue his campaign against white men, free from the inconvenience of the sunshine laws that govern state universities.

Posted by: Jimbolaya at April 24, 2015 06:37 PM (4HYng)

90 Feminist Privilege.

Posted by: Pappy O'Daniel at April 24, 2015 06:38 PM (YvRAm)

91 It will be a shame if good, long jail sentences for Sulkowicz, Gillibrand, and as many of the enablers from Columbia University weren't the final result of this. Still, I hope that Nungesser ends up with a settlement in the eight figures from these lowlives.

Posted by: Sasquatch at April 24, 2015 06:39 PM (Orv1g)

92 >Yeah, there was a part in her story in which she talks about waking up and he was gone.

Did he chew off his own arm?

Posted by: Pappy O'Daniel at April 24, 2015 06:39 PM (YvRAm)

93 Yeah, there need to be three defendants in this case.

Posted by: Burn the Witch at April 24, 2015 06:39 PM (xSCb6)

94 79 I think I'll skip reading the lawsuit and wait for the porn parody version to come out. From the look of things, Miss Sulkowicz might have the opportunity to portray herself.

Posted by: Emmet Milbarge at April 24, 2015 06:35 PM (nFdGS)




Now playing at the local cineplex, "Let's Go To The Mattresses!", starring Sandra Fluke, and featuring Zombie John Holmes!

Posted by: Jay Guevara at April 24, 2015 06:39 PM (oKE6c)

95 Think anyone is dating her now?

Posted by: Bruce J. at April 24, 2015 06:39 PM (iQIUe)

96 The male students threatening him are nuts, too. Has every guy been neutered?
Posted by: Bruce J.

White knights. Pajama boys think that making internet-tough-guy threats and talking shit will get them some progtard pussy. They want to punch their ticket out of the friend zone.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 06:40 PM (Q/rld)

97 I hope his lawsuit includes her and that all she's left with is that mattress.

The label would have to have an addendum: "rayon, springs, foam, e. coli"

Posted by: boulder terlit hobo at April 24, 2015 06:40 PM (AVEe1)

98 So how fuckin stupid is Gillibrand?
"Hey, there's a chick up at Columbia walking around with a mattress on her back!"
"That's great! Let's invite her to the State of the Union speech. What could possibly go wrong?"

Posted by: tu3031 at April 24, 2015 06:41 PM (YFFpo)

99 Hey Moron Lawyers,


Can he drag Senator Kirsten Gillibrand into the lawsuit?

Without her horsefuckery these psycho-allegations probably would've died the quick death they deserved?

Posted by: naturalfake at April 24, 2015 06:41 PM (KUa85)

100 Stockholm is missing a victim or two or three...

Posted by: Anna Puma (+SmuD) at April 24, 2015 06:42 PM (lQHc1)

101 She'll be a front page feature cam-girl on chaturbate soon enough. Got a bright future.

Posted by: BuckIV at April 24, 2015 06:42 PM (CLfqv)

102 93: Four. The mattress is right now listed as an un-named co-conspirator.

Posted by: Manolo at April 24, 2015 06:42 PM (NCVM7)

103 White knights. Pajama boys think that making
internet-tough-guy threats and talking shit will get them some progtard
pussy. They want to punch their ticket out of the friend zone.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 06:40 PM (Q/rld)


Wait - they want to tie into this crazy bitch, or others of the same ilk? Are they THAT desperate?

Posted by: Jay Guevara at April 24, 2015 06:42 PM (oKE6c)

104 59
I really dont understand this running to the school dean instead of the cops to report an assault. That's what the Lena chick did. Not sure is this one did, too.
Posted by: Bruce J. at April 24, 2015 06:31 PM (iQIUe)

****************

Extremely sketchy evidence rules, low bar for the standard of proof, and often no chance for the accused to face his accuser, or even attend the proceedings.


Easy way to "punish" one's spurner.

Posted by: Bob's House of Flannel Shirts and Wallet Chains at April 24, 2015 06:42 PM (vgIRn)

105 If she thinks this is going to work, she really is nuts:

"We've reached out to both Nungesser's attorney, Andrew T. Miltenberg, and Sulkowicz for comment, and will update if we hear back. In emails to the Associated Press and the New York Times, Sulkowicz called the lawsuit "ridiculous." She writes:

I think it's ridiculous that Paul would sue not only the school but one of my past professors for allowing me to make an art piece. It's ridiculous that he would read it as a bullying strategy, especially given his continued public attempts to smear my reputation, when really it's just an artistic expression of the personal trauma I've experienced at Columbia. If artists are not allowed to make art that reflect on our experiences, then how are we to heal?"

Posted by: Bruce J. at April 24, 2015 06:43 PM (iQIUe)

106 Ms. Sulkowicz has been cast in Butt Burglars Part III: Revenge of the Sphincter.

Posted by: Afroman at April 24, 2015 06:44 PM (uTc5j)

107 Hell hath no fury like that of a cray-cray young women with a mattress and an insane fixation upon another person.

Posted by: Anna Puma (+SmuD) at April 24, 2015 06:44 PM (lQHc1)

108 Hey, Jean-Paul, welcome to America? How you like it so far?

Posted by: Jay Guevara at April 24, 2015 06:44 PM (oKE6c)

109 This is to be expected, considering Columbia is the epicenter of commie jacktardism.

Posted by: Titanium at April 24, 2015 06:45 PM (u9UgT)

110 Read the texts.

Dear lord. Pro tip, sweetie, if you're having to beg a guy to use conforms when he screws other women, he's just not that in to you.

Posted by: Lauren at April 24, 2015 06:45 PM (ZLNps)

111 106 Ms. Sulkowicz has been cast in Butt Burglars Part III: Revenge of the Sphincter.

Posted by: Afroman at April 24, 2015 06:44 PM (uTc5j)




I'd be referring to her as "Pinto," because ... well ... you know. After they got rear-ended, they blew up.

Posted by: Jay Guevara at April 24, 2015 06:46 PM (oKE6c)

112 Apparently she's quite sex-positive" - had sex with all of John Does's friends, including the poor dued accused of rape. Even complained to him about STDs.

Chick is just a messed up person and directed all on Nungesser.


Think it's fair to say feminists/Leftists who have been telling women to have sex like men and there's not maximum on partners (don't slut shame!) encouraged her to take this path. And it obviously made her used and unfulfilled - to the point that she felt raped.


Posted by: Lizzy at April 24, 2015 06:46 PM (2TN4k)

113 He fucked her in the butt?

The perfect time to break-up!

Posted by: Hollywood Book of Manners at April 24, 2015 06:46 PM (KUa85)

114
How much you wanna bet she's Alanis Morisette's biggest fan?

Posted by: Soothsayer, Inc. -- The King Unwilling at April 24, 2015 06:46 PM (Tk6Z0)

115 The crazy comments at Jezebel are crazy:

http://goo.gl/QXHPpI

I love how they refer to him as a serial rapist. smh

Posted by: Bruce J. at April 24, 2015 06:46 PM (iQIUe)

116 About what he alleges her conduct was

He says her facebook messages admit sex with her boyfriend at the time and all his friends. Ace rightfully expresses skepticism of some of these "bad acts"

However the plaintiff does not have to prove she behaved that way. It is enough to show that she SAID she behaved that way. Even if she lied about having drunk sex with all those people, it shows.....SHE LIES ABOUT SEX

Posted by: ThunderB at April 24, 2015 06:46 PM (zOTsN)

117 "We've reached out to both Nungesser's attorney



Ah, there's their mistake. They should've contacted him instead.

Posted by: Jay Guevara at April 24, 2015 06:46 PM (oKE6c)

118
We have to protect ace. He's always sweet on these cray cray girls.

Posted by: Bruce J. at April 24, 2015 06:47 PM (iQIUe)

119 Think anyone is dating her now?"

Wrong verb.

Posted by: anon a mouse at April 24, 2015 06:47 PM (KnbYp)

120
Art project, my ass.

She's nothing but an attention-seeker.

Posted by: Soothsayer, Inc. -- The King Unwilling at April 24, 2015 06:47 PM (Tk6Z0)

121 >>'d be referring to her as "Pinto,"


*Golf clap*

Posted by: Lizzy at April 24, 2015 06:47 PM (2TN4k)

122 I'd be referring to her as "Pinto," because ... well ... you know. After they got rear-ended, they blew up.

Or maybe Corvair...the engine's in the back.

Posted by: Diogenes at April 24, 2015 06:47 PM (08Znv)

123 I love how they refer to him as a serial rapist. smh

Posted by: Bruce J. at April 24, 2015 06:46 PM (iQIUe)


Is that before or after they ask for his contact info?

Posted by: Jay Guevara at April 24, 2015 06:47 PM (oKE6c)

124 Oh, we HAVE to set this ass bandida up with the parallel universe guy.

Posted by: boulder terlit hobo at April 24, 2015 06:47 PM (E5hbC)

125 How much you wanna bet Emma Sulkowicz' nickname is-


Sulky?

Posted by: naturalfake at April 24, 2015 06:48 PM (KUa85)

126 Unlike Haven, Nungesseger stuck his peen in crazy.

Posted by: Titanium at April 24, 2015 06:48 PM (u9UgT)

127 Wait - they want to tie into this crazy bitch, or others of the same ilk? Are they THAT desperate?
Posted by: Jay Guevara

My Guess: they mostly think "it won't happen to me, I'm a good progressive." They don't realize The Crazy doesn't care about that, The Crazy only knows penis=guilt.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 06:48 PM (Q/rld)

128 @111 - Well played, sir!

Posted by: Afroman at April 24, 2015 06:48 PM (uTc5j)

129
Her next stop on her journey is lesbianism, cutting, and then suicide.

Posted by: Soothsayer, Inc. -- The King Unwilling at April 24, 2015 06:48 PM (Tk6Z0)

130 Lesson: Don't dork crazy chicks up the pooper.

Posted by: Costanza Defense at April 24, 2015 06:49 PM (ZPrif)

131 If she was so traumatized at Columbia why didn't she transfer? This supposedly happened what-three years ago ? No- crazy narcissist wants attention and turns her trauma into a project. Since when is carrying around a mattress "art" Columbia-completely loony toons.

Posted by: FenelonSpoke at April 24, 2015 06:49 PM (DXzRD)

132 Nungesser, you fool. Emma is so hawt! She's a real catch. Don't let her get away, or you'll always regret it. I wouldn't be telling you this if it weren't true!

-Haven Monahan

Posted by: (sent from Emma's iphone) at April 24, 2015 06:49 PM (XrHO0)

133 Universities really have to be sued over this stuff.

They really don't like the new Obama administration rape rules. They like the idea in theory but they don't want to be running trials and having visits from the Civil Rights Division of the Justice Department.

They think they're on the right side of social justice (BTW, did you know that the infamous Father Coughlin had a magazine called "Social Justice" and popularized the term in the US? I didn't.) and don't like being thought of as places with Bad People.

If schools get sued, they'll push back.

Posted by: AmishDude at April 24, 2015 06:50 PM (b4b5c)

134 Here's "Pinto" in action: https://www.youtube.com/watch?v=rcNeorjXMrE

Posted by: Jay Guevara at April 24, 2015 06:50 PM (oKE6c)

135 I still haven't seen someone point out how ugly she is. That's what's important to me, and the real reason why she's so upset.

Posted by: FDR's TV at April 24, 2015 06:50 PM (ne2fm)

136 Did you know the CIA developed a time-release rape bomb? Don't be naive about the cloud seeding--we're all infected.

Posted by: Wah Wah Sisterhood at April 24, 2015 06:50 PM (jT+gh)

137 >>""If artists are not allowed to make art that reflect on our experiences, then how are we to heal?"

It's all me, me, me, I, I , I.....calling it "art" doesn't exempt you from the law, sugar cheeks.

Posted by: Lizzy at April 24, 2015 06:50 PM (2TN4k)

138 I hate to pull rank on you, ma'am...

But, I'm with the Mattress Pllice and there are no tags on this mattress.

Posted by: Fletch at April 24, 2015 06:51 PM (9cwxE)

139 Ima thinking there's a place called an "institution" in her future.
Because aren't all "artists" crazy?

Posted by: tu3031 at April 24, 2015 06:51 PM (YFFpo)

140 79 I think I'll skip reading the lawsuit and wait for the porn parody version to come out. From the look of things, Miss Sulkowicz might have the opportunity to portray herself.

Posted by: Emmet Milbarge at April 24, 2015 06:35 PM (nFdGS)


I'm waiting for the Taiwanese CGI animated version.

Posted by: antisocial justice beatnik at April 24, 2015 06:52 PM (l3LvV)

141 Who says her "art" is any good? What would her thesis have been if she hadn't lied about this

Posted by: ThunderB at April 24, 2015 06:52 PM (zOTsN)

142 >>I love how they refer to him as a serial rapist.


So now "Friend with benefits" <-------------Serial Rapist?

Posted by: Lizzy at April 24, 2015 06:52 PM (2TN4k)

143 I don't know about that 11:00.

I'm generally feeling my rapiest between 12:00 and 2:30. Usually after the bar closes, whenever that is.

Posted by: Hank at April 24, 2015 06:52 PM (K+1ie)

144 A) She's ugly.

B) The perfessor should be sued just for calling an ignorant stunt like this 'art.'

Posted by: Pappy O'Daniel at April 24, 2015 06:53 PM (YvRAm)

145
What if ace kisses a girl at a party and ends up being charged with rape and is thrown in the slammer? How can we protect the little guy?

Posted by: Bruce J. at April 24, 2015 06:53 PM (iQIUe)

146 Her next stop on her journey is lesbianism, cutting, and then suicide.

Probably a lot of truth to this. Once she runs out of money to live the student life, she will be out in the real world. And it won't be nice.

Posted by: Diogenes at April 24, 2015 06:53 PM (08Znv)

147 Ray Ban doesn't want Rand Paul to wear their sunglasses.

Posted by: steevy at April 24, 2015 06:53 PM (mGBKM)

148 So she's the daughter of two psychiatrists from Manhattan? Whoa - crazy is pretty much baked into the cake, methinks.

Posted by: Jay Guevara at April 24, 2015 06:54 PM (oKE6c)

149 She's actually a 9/9 on the crazy/hot scale. Okay, maybe a 12/9, but she's rather hawt. And likes Teh Butt Secks.

Posted by: Afroman at April 24, 2015 06:54 PM (uTc5j)

150 Wait the bitch like anal?

OK then she's cool

Posted by: Wonkette at April 24, 2015 06:55 PM (0FSuD)

151 119 Think anyone is dating her now?"

Wrong verb.


Linking verbs strike the page in a phallic fashion, therefore evil.

Posted by: Wah Wah Sisterhood, English Graduate Studies at April 24, 2015 06:55 PM (jT+gh)

152 >>Wait - they want to tie into this crazy bitch, or others of the same ilk? Are they THAT desperate?


These pajamaboy white knights are the same ones who attend abortion rallies and slut walks. Wanna prove their the perfect feminist boyfriend material in order to get laid.

Posted by: Lizzy at April 24, 2015 06:55 PM (2TN4k)

153 Shame no one ever told her that just because a guy has sex with you it doesn't mean he loves you. He may not even like you

Posted by: ThunderB at April 24, 2015 06:55 PM (zOTsN)

154 Ray Ban can kiss Rand's ass in Macy's window at lunch time.

Posted by: Hank at April 24, 2015 06:55 PM (K+1ie)

155 Only on college campuses can behavior like this be considered "normal," and --in fact-- expected. When I was prepping my son for college I tried to explain this as one of the types of risks of college relationships. Talk about a hard conversation to have.

Posted by: Manolo at April 24, 2015 06:56 PM (NCVM7)

156 No guy wants a girl who drunk fucks his friends

Posted by: ThunderB at April 24, 2015 06:56 PM (zOTsN)

157 Wanna prove their the perfect feminist boyfriend material in order to get laid.


Posted by: Lizzy at April 24, 2015 06:55 PM (2TN4k)


"Feminist boyfriend?" I love oxymorons, but that's going too far.

Posted by: Jay Guevara at April 24, 2015 06:56 PM (oKE6c)

158 So she's the daughter of two psychiatrists from Manhattan?

Really? Well, isn't baby cakes a shining example of their competence...

Posted by: tu3031 at April 24, 2015 06:57 PM (YFFpo)

159 Emma needs a larger mattress...

Posted by: tbd at April 24, 2015 06:57 PM (eHRTo)

160 156 No guy wants a girl who drunk fucks his friends
Posted by: ThunderB at April 24, 2015 06:56 PM (zOTsN)


This is the only reason the guy has friends. LOL

Posted by: just bob at April 24, 2015 06:57 PM (wkuqO)

161 He raped me with his mind thoughts.

Posted by: SpongeBobSaget at April 24, 2015 06:58 PM (zauWW)

162 156 No guy wants a girl who drunk fucks his friends

Posted by: ThunderB at April 24, 2015 06:56 PM (zOTsN)




Imagine the gags his friends were swapping. The first guy to bop her earnestly looks up from his beer at the other guys and says it now burns when he pees, just to catch their reaction.

Posted by: Jay Guevara at April 24, 2015 06:59 PM (oKE6c)

163
23 she's pretty much made herself unemployable except for government or academia.
Posted by: X at April 24, 2015 06:19 PM (n5fTN)



She's doing a senior art project. In college. She is unemployable even by the government. Now getting a ten million dollar grant from the NEA is a different story.

Posted by: Buzzion at April 24, 2015 07:00 PM (FTeeu)

164 OregonMuse! Nice to see you out and about. (By the way, try the Opera browser if you're still on the lookout. I prefer the old v 12, but whichever..)

On topic: I am related to a Columbia student and I'll inquire whether this is a thing or just a blog-thing that we 10%ers even hear about.

Posted by: Insert Clever Name Here at April 24, 2015 07:00 PM (XMX7O)

165 No guy wants a girl who drunk fucks his friends

Reminds me of Jackie. She thought that she could make "Ryan" jealous. Most guys would just stay away.

Posted by: AmishDude at April 24, 2015 07:00 PM (b4b5c)

166 tension ho ?

Posted by: seamrog at April 24, 2015 07:00 PM (bZG+P)

167 Broken hearts are for assholes

Posted by: boulder terlit hobo at April 24, 2015 07:01 PM (E5hbC)

168 >>"Feminist boyfriend?" I love oxymorons, but that's going too far.

IKR, but who do you think coined the phrase?
Feminists.

http://preview.tinyurl.com/nq54kea


Posted by: Lizzy at April 24, 2015 07:01 PM (2TN4k)

169 These pajamaboy white knights are the same ones who attend abortion rallies and slut walks. Wanna prove their the perfect feminist boyfriend material in order to get laid.

Posted by: Lizzy at April 24, 2015 06:55 PM (2TN4k)

They're the guys with the "why do girls always like the jerks" lament after the girls tell them; "You're a great guy, I like you as a friend!"

Posted by: kbdabear at April 24, 2015 07:02 PM (GrXXa)

170 So it's not "surprise anal" that prompted her rape hoax, as previously speculated. She was just angry because she craved even more anal.

Posted by: wooga at April 24, 2015 07:02 PM (qlxfZ)

171 Reminds me of Jackie. She thought that she could make "Ryan" jealous. Most guys would just stay away.

Posted by: AmishDude at April 24, 2015 07:00 PM (b4b5c)


Exactly. Lousy psychology, to think that balling some other guy is going to light a fire under a guy who passed when he had a clear shot.

The most likely reaction on the guy's part: relief that she'll be off his case now.

Posted by: Jay Guevara at April 24, 2015 07:02 PM (oKE6c)

172 Sulky?

Guess too horse connected, think of a form of horse racing. Now if we could put Jean Francois and Sarah Jessica in harness and have them spin around the track with the other horses...

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:02 PM (lQHc1)

173 Broken hearts are for assholes
Posted by: boulder terlit hobo

And broken assholes are for closers.

Posted by: Reggie Love at April 24, 2015 07:03 PM (Q/rld)

174 >>Shame no one ever told her that just because a guy has sex with you it doesn't mean he loves you. He may not even like you



Butt Sexx is for Lovers, Virginia.

Posted by: Bob McDonnel at April 24, 2015 07:03 PM (9cwxE)

175 No she craved a boyfriend and all she ever got to was "fuck buddy" status

Posted by: ThunderB at April 24, 2015 07:03 PM (zOTsN)

176 >>"Feminist boyfriend?" I love oxymorons, but that's going too far.

IKR, but who do you think coined the phrase?
Feminists.

Posted by: Lizzy at April 24, 2015 07:01 PM (2TN4k)




More of that vaunted feminist sense of humor.

Posted by: Jay Guevara at April 24, 2015 07:03 PM (oKE6c)

177
58 She texted him asking for Teh Butt Secks. Not that there's anything wrong with that...
Posted by: Afroman at April 24, 2015 06:30 PM (uTc5j)



Just remember alexthechicks advice...

Posted by: Buzzion at April 24, 2015 07:04 PM (FTeeu)

178 >>More of that vaunted feminist sense of humor.

THAT'S NOT FUNNY

Posted by: Feminists at April 24, 2015 07:04 PM (2TN4k)

179 167 Broken hearts are for assholes

Apparently she thinks many things are for her asshole.

Posted by: wooga at April 24, 2015 07:04 PM (qlxfZ)

180 Aide to Sen Thad Chochran MS R

Arrested. Someone sent him a kilo of date rape drug
he was going to distribute in exchange for sex.

http://tinyurl.com/pa6eswr
according to Fox New

Posted by: Gander Lander at April 24, 2015 07:04 PM (DsP0g)

181 Just gotta say - when my son gets to college, I'm setting him up with a hooker allowance. Less risk than dealing with a psycho like this.

Posted by: @JohnTant at April 24, 2015 07:05 PM (CVTpV)

182 Feminist boyfriend?

So they the ones at the rallies wearing the red pumps with a Murse slung over a shoulder? Talk about Omegas...

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:05 PM (lQHc1)

183 120


Art project, my ass.



If you change that comma to a colon, you could get college credit at Columbia.

Posted by: The Poster Formerly Known as Mr. Barky at April 24, 2015 07:05 PM (4KoRb)

184 I know now about two Nungessers - this guy and the WWI French ace.

Posted by: I have doubled my knowledge of Nungessers in one day! at April 24, 2015 07:05 PM (weeeU)

185 No she craved a boyfriend and all she ever got to was "fuck buddy" status
--
She gave up the butt thinking he'd like her more - but you can never skank your way to a man's heart.

Posted by: Costanza Defense at April 24, 2015 07:06 PM (ZPrif)

186 No guy wants a girl who drunk fucks his friends

Posted by: ThunderB at April 24, 2015 06:56 PM (zOTsN)


Yeesh.

It's basic biology people.


No guy no guy wants a serious relationship with Whorey McSlutterton.

Banging Whorey McSlutterton?

Sure. Just be sure to "suit up".


But, a real loving relationship leading to marriage.

No fucking way.

Why?


You don't want to be bringing home your paycheck to support a bunch of her lovers' bastards.

Modesty may not equal loyalty, but you certainly have a better shot at not raising a bunch of bastards as Cuckold Joe.

Posted by: naturalfake at April 24, 2015 07:06 PM (KUa85)

187
Exactly. Lousy psychology, to think that balling some other guy is going to light a fire under a guy who passed when he had a clear shot.


These girls are young, inexperienced, and had their heads filled with feminist horseshit. The most they probably know about male psychology is 'Twilight.'

Posted by: Pappy O'Daniel at April 24, 2015 07:07 PM (YvRAm)

188 Art project, my ass.




ISWYDT.




If you change that comma to a colon, you could get college credit at Columbia.



ISWYDT2.

Posted by: Jay Guevara at April 24, 2015 07:07 PM (oKE6c)

189 i've always depended on the kindness of strangers.

Posted by: Streetcar Named D'liar at April 24, 2015 07:07 PM (jT+gh)

190 I'm setting him up with a hooker allowance.

Let him pay for his own hookers. It teaches-uhh-the value of money.

Posted by: FenelonSpoke at April 24, 2015 07:07 PM (DXzRD)

191 Surprise anal?

Posted by: The Porpoise at April 24, 2015 07:07 PM (uTc5j)

192 The exploding Pinto was a myth (lie) created by tort lawyers for bucks. And that video of the exploding Pinto is most likely one made by a certain lying news orgnaization that was known to put incendiary devices in those cars when they hyped the explosion.


I never understood why Ford did not sue as chevy did when they went after their trucks the same way.


The fact is that Pintos were no more likely to catch fire from an impact than any other car of the day. And for any of them to catch on fire from a rear end crash the terminal; velocity of the car crashing into them had to be above 50 mph and that is extremlely rare.

Posted by: Vic We Have No Party at April 24, 2015 07:07 PM (wlDny)

193 Her mama and her daddy should've told her

Posted by: ThunderB at April 24, 2015 07:07 PM (zOTsN)

194 "Nobody expects the surprise anal Inquisition!" - Pope Porpoise XIIIth

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:08 PM (lQHc1)

195 149 She's actually a 9/9 on the crazy/hot scale. Okay, maybe a 12/9, but she's rather hawt. And likes Teh Butt Secks.
-------------------
Which deserves a little up-weighting on both scales, IYKWIM

Posted by: JDub (was BunkerintheBurbs) at April 24, 2015 07:08 PM (X3xYu)

196 You don't want to be bringing home your paycheck to support a bunch of her lovers' bastards.



Modesty may not equal loyalty, but you certainly have a better shot at not raising a bunch of bastards as Cuckold Joe.





Posted by: naturalfake at April 24, 2015 07:06 PM (KUa85)


Yeah, who wants a whole bunch of guys standing outside the delivery room handing out cigars and arguing over who is actually the father?

Posted by: Jay Guevara at April 24, 2015 07:08 PM (oKE6c)

197 >>No she craved a boyfriend and all she ever got to was "fuck buddy" status

Honestly, those texts are just sad. She comes off really needy, especially the bragging (?) that she had slept with all of John Doe's (he primary fuck buddy?) friends. Ick.

Posted by: Lizzy at April 24, 2015 07:09 PM (2TN4k)

198 The exploding Pinto was a myth (lie) created by tort
lawyers for bucks. And that video of the exploding Pinto is most likely
one made by a certain lying news orgnaization that was known to put
incendiary devices in those cars when they hyped the explosion.




Posted by: Vic We Have No Party at April 24, 2015 07:07 PM (wlDny)

Yeah, I know, but I couldn't resist the joke.

Posted by: Jay Guevara at April 24, 2015 07:09 PM (oKE6c)

199 Her texts are sad and pathetic but she tried to ruin this guys life

I am not joking about her parents. They should've raised her better

Posted by: ThunderB at April 24, 2015 07:10 PM (zOTsN)

200 Ralph Nader should burn in Hell for all the lies he committed in the name of 'Auto Safety'

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:10 PM (lQHc1)

201 Hey Guevara thanks and tell Ace that I'm expecting an extended free membership. Hell if you read this site long enough, these abnormal thoughts become everyday conversation.

Posted by: The Poster Formerly Known as Mr. Barky at April 24, 2015 07:11 PM (4KoRb)

202 And likes Teh Butt Secks.



Emma, call me.

Posted by: Bawney Frank at April 24, 2015 07:11 PM (oKE6c)

203 so join me as I sing
of an activity that's fun!
https://www.youtube.com/watch?v=Ulb0pLBgRCw

Posted by: boulder terlit hobo at April 24, 2015 07:12 PM (W540W)

204 >>Her texts are sad and pathetic but she tried to ruin this guys life



Agreed. It's sad, but what she did to this guy is worse. Glad there's enough of an text trail to demonstrate the crazy and the willingness.

Posted by: Lizzy at April 24, 2015 07:12 PM (2TN4k)

205 Just remember alexthechicks advice...
Posted by: Buzzion at April 24, 2015 07:04 PM (FTeeu)
---
Okay, I'll bite...

Posted by: All Hail Eris at April 24, 2015 07:12 PM (KH1sk)

206 As I mentioned earlier today, Title IX is gender neutral. Columbia is about to learn that lesson hard.

How the school thought that giving her college credit for this was acceptable is beyond me.

You know what I would like to see? Legislation that provides for a private cause of action when the confidentiality provisions of FERPA and Title IX sexual assault star chamber investigations are violated. Put some teeth into it, including mandatory and automatic monetary sanctions against the school itself. That should help this whole only one side obeying them problem.

Posted by: alexthechick - Come to us SMOD at April 24, 2015 07:12 PM (IrByp)

207 Hell if you read this site the news long enough, these abnormal thoughts become everyday conversation.


Posted by: The Poster Formerly Known as Mr. Barky at April 24, 2015 07:11 PM (4KoRb)


FIFY.

Posted by: Jay Guevara at April 24, 2015 07:13 PM (oKE6c)

208 Glad we didn't hit it.

Posted by: The Other 3+ Billion guys on Earth at April 24, 2015 07:13 PM (DL2i+)

209 "Columbia is about to learn that lesson good and hard"

Fixed

Posted by: boulder terlit hobo at April 24, 2015 07:13 PM (W540W)

210 "You want to know who you are? Huh? You want to know who's son you are? You don't; I do--everybody does... you're the son of a thousand fathers, all bastards like you!"

Posted by: Dr. Tuco, OB-GYN at April 24, 2015 07:14 PM (jT+gh)

211 Kinda off topic, but where does one put the mattress when, say you go in a classroom or a campus coffee shop?
Does she park it outside?

Also, I love that it was her Art class thesis. I mean, can you imagine the Professor faced with saying no to this asshole?

Posted by: Ktgreat at April 24, 2015 07:14 PM (Bl4dy)

212 always changed their stories and appeared deceptive and evasive.

Story of Obama Hillary again.

Posted by: DaveA at April 24, 2015 07:14 PM (DL2i+)

213 Ewwwwww. Quit reading after one page.
Very, VERY, glad that I don't have a kid in school.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 07:14 PM (F2IAQ)

214 It's just filled with a lot of stuff that makes you think her claims are not credible.

Posted by: ace at April 24, 2015 06:22 PM (PA7DS)


Kinda like a Rolling Stone article.

Posted by: nerdygirl at April 24, 2015 07:15 PM (kGrwF)

215 They be some crazy damn people come out of Columbia. And Occidental. And Harvard, too.

Posted by: Eromero at April 24, 2015 07:15 PM (go5uR)

216 Kinda off topic, but where does one put the mattress when, say you go in a classroom or a campus coffee shop?

Does she park it outside?



Also, I love that it was her Art class thesis. I mean, can you imagine the Professor faced with saying no to this asshole?

Posted by: Ktgreat at April 24, 2015 07:14 PM (Bl4dy)


At least she managed to get it through doorways and gateways. Barky couldn't figure out how to get an umbrella through one.

Posted by: Jay Guevara at April 24, 2015 07:15 PM (oKE6c)

217 Just remember alexthechicks advice...
Posted by: Buzzion at April 24, 2015 07:04 PM (FTeeu)


Actually, I'm pretty sure that ignoring my sage advice re: lube is part of what led to this.

Also that she's a Next Level Bunny Boiler.

Posted by: alexthechick - Come to us SMOD at April 24, 2015 07:15 PM (IrByp)

218 nungesser the bunpresser

jizi jexn

Posted by: seamrog at April 24, 2015 07:16 PM (bZG+P)

219 Also, I love that it was her Art class thesis. I mean, can you imagine the Professor faced with saying no to this asshole?

Posted by: Ktgreat at April 24, 2015 07:14 PM (Bl4dy)

__________
Poor choice of words, in the circumstances.

Posted by: Jay Guevara at April 24, 2015 07:16 PM (oKE6c)

220 Ralph Nader should burn in Hell for all the lies he committed in the name of 'Auto Safety'
Posted by: Anna Puma
----------------

Tell me about it.

Posted by: Corvair, dead and buried. at April 24, 2015 07:16 PM (F2IAQ)

221 Kinda off topic, but where does one put the mattress when, say you go in a classroom or a campus coffee shop?
Does she park it outside?
Posted by: Ktgreat

You realize this is handicap mattress parking? License and registration.

Posted by: Campus Fuzz at April 24, 2015 07:16 PM (Q/rld)

222 Doesn't 645M$ annually work out to ~2-fiddy/murican?

Posted by: DaveA at April 24, 2015 07:17 PM (DL2i+)

223 Also, I love that it was her Art class thesis. I mean, can you imagine the Professor faced with saying no to this asshole?

Posted by: Ktgreat at April 24, 2015 07:14 PM (Bl4dy)


Mein Gott, how I wished I'd said "no" to the asshole.

Posted by: Jean-Paul Nungesser at April 24, 2015 07:17 PM (oKE6c)

224 Title IX is gender neutral. Columbia is about to learn that lesson hard.
-----


Yeah and hate crime can be applied when victims are white too.

Posted by: Buzzion at April 24, 2015 07:17 PM (FTeeu)

225 Also that she's a Next Level Bunny Boiler.
Posted by: alexthechick
-------------------

Radioactive.

Posted by: Corvair, dead and buried. at April 24, 2015 07:17 PM (F2IAQ)

226 The Leftist Feminist mindset is truly a landscape of abnormal psychology. It cripples people.

A supremely self-indulgent mindset is cultivated. Everything should be given to them on at least a silver platter. Because? They have ovaries and if not, hear them whine for restitution.

And it used to be Women's Equality was all about "Sisters doing it for themselves."

You have certainly come a long way baby. Right back to the fainting couch but even less capable of handling real life.

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:17 PM (lQHc1)

227 Just to settle a bet, does anybody actually do any academic work at university any more? Where do they find the time, and the energy?

Posted by: Jay Guevara at April 24, 2015 07:18 PM (oKE6c)

228 I am sure her probably deeply progressive parents raised her with out boundaries, or a sense of self respect

Posted by: ThunderB at April 24, 2015 07:18 PM (zOTsN)

229 At least she managed to get it through doorways and gateways. Barky couldn't figure out how to get an umbrella through one.
Posted by: Jay
-------------------

Eleanor Holmes Norton would have smashed into the adjacent mattress.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 07:18 PM (F2IAQ)

230 I am sure her probably deeply progressive parents raised her with out boundaries, or a sense of self respect
Posted by: ThunderB
----------------

... and are very proud of her.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 07:19 PM (F2IAQ)

231 211 Kinda off topic, but where does one put the mattress when, say you go in a classroom or a campus coffee shop?
Does she park it outside?


Like the skateboards, it would probably be propped up against a back wall, leaving its oily residue for future generations to venerate.

Posted by: Underclassmen legacy at April 24, 2015 07:19 PM (jT+gh)

232 Ka-razy Sluts Attack!

Posted by: Dave at April 24, 2015 07:19 PM (/iRd9)

233 And it used to be Women's Equality was all about "Sisters doing it for themselves."


Oh, there's lots of those too. Especially in women's colleges, the WNBA, the LPGA, and any number of female softball teams.

Posted by: Jay Guevara at April 24, 2015 07:19 PM (oKE6c)

234 So, what brand of mattress did she prefer?

Simmons?

Tempur-Pedic?

Posted by: naturalfake at April 24, 2015 07:20 PM (KUa85)

235
So another narcissist (Munchausen's?) is a lying liar who lies.

WTF is it with these women? Have they no shame?

I confess to watching the worst reality show on TV, Southern Charm. The mother of the executive producer noted "back in my day, if a girl got knocked up, she was sent away ... and her parents changed their name and moved to Missoula"

I kind of wish some of that shame culture would come back. For crying out loud, stop having casual sex!You would think it would be embarrassing to parade around as the butt sex victim, but she REVELS in it (I knowher entire story isnot true, but didn't people used to lie about being virgins, not about NOT being virgins? Or lie to make themselves look better, not worse?)

I smelled a rat as soon as Jackie said frat boys raped her. All a frat boy needs to do to get laid is jingle his BMW keys.
All a guy with a good accent needs to get laid is to jingle his vespa keys, and a certain type of girl will have her clothes off in a new York minute.

Posted by: the other coyote at April 24, 2015 07:20 PM (yK44T)

236 probably be propped up against a back wall, leaving its oily residue for future generations to venerate.
Posted by: Underclassmen
---------------------------

heh
'oily residue'

Posted by: Mike Hammer, etc., etc. at April 24, 2015 07:21 PM (F2IAQ)

237 Who would sue over anal?


Rude

Posted by: Wonkette at April 24, 2015 07:21 PM (0FSuD)

238 "I'm not just the daughter of two prominent psychologists... I'm also a client."

Posted by: boulder terlit hobo at April 24, 2015 07:21 PM (W540W)

239
I am sure her probably deeply progressive parents raised her with out boundaries, or a sense of self respect

Posted by: ThunderB

----------------



... and are very proud of her.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 07:19 PM (F2IAQ)

A liberal acquaintance of mine allowed as how his daughter and her female "friend" aren't married legally, but ...
It was clear he was totally approving. If they do get "married," I think I'll buy them a top of the line turkey baster.

Posted by: Jay Guevara at April 24, 2015 07:21 PM (oKE6c)

240 I expect people to have sex. But not to get people to love them, like a hook or an anchor. Or a weapon

Posted by: ThunderB at April 24, 2015 07:21 PM (zOTsN)

241 "Asshole".
Yeah, I was trying to call her a name without using a word that also meant/implied "crazy". She isn't crazy, she's a vicious shrew who thought nothing of ruining a guys life.

Posted by: Ktgreat at April 24, 2015 07:22 PM (Bl4dy)

242 Keep it greasy.

Posted by: zombie Zappa at April 24, 2015 07:22 PM (9cwxE)

243 "oily residue"??

Guess what, that could open a whole new level of litigation. Why? The health nazis are now going after third hand smoke, the physical residue left in carpets from somebody smoking. *thud*

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:22 PM (lQHc1)

244 "I'm not just the daughter of two prominent psychologists... I'm also a client."
Posted by: boulder terlit
--------------

Me too!

Posted by: Lena Dunham at April 24, 2015 07:22 PM (F2IAQ)

245 She wouldn't be getting sued if she'd smeared some shit on the mattress.

Posted by: Tawana Brawley at April 24, 2015 07:23 PM (QRz0C)

246
"oily residue"??



Olestra?

Posted by: Jay Guevara at April 24, 2015 07:24 PM (oKE6c)

247 I think I'll buy them a top of the line turkey baster.
Posted by: Jay Guevara
-------------

Funny...., but these days might make you a party in the subsequent child support litigation.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 07:25 PM (F2IAQ)

248 245 She wouldn't be getting sued if she'd smeared some shit on the mattress.
Posted by: Tawana Brawley at April 24, 2015 07:23 PM (QRz0C)



Uh you did get sued. And lost. And keep changing jobs to try and avoid paying.

Posted by: Buzzion at April 24, 2015 07:25 PM (z/Ubi)

249 Buzzion, you forget Tawana also converted to Islam.

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:26 PM (lQHc1)

250 I guess that's Bootywicz's next move, heading off to the caliphate

Posted by: boulder terlit hobo at April 24, 2015 07:28 PM (W540W)

251 Imagine the Monica Lewinsky effect at work here. Whoever marries/married Lewinsky KNOWS that anyone he introduces her to is thinking the exact same thing.


Now, same thing with young Emma Royd here. You KNOW that anyone who meets her will be watching her walk away to see if she's walking a bit funny.

Posted by: Jay Guevara at April 24, 2015 07:28 PM (oKE6c)

252 Speaking of anal and college...


It was well known that girls from certain countries where a certain 'splodey religion was very popular.

Would absolutely NOT engage in PIV, however-

were very willing to give up the booty

as a way to keep their boyfriends and still remain a virgin for when they went back home to marry.

Posted by: naturalfake at April 24, 2015 07:29 PM (KUa85)

253 Buzzion, you forget Tawana also converted to Islam.
Posted by: Anna Puma (+SmuD)

So she wasn't lying, she was committing taqiyyah in the name of jihad.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 07:29 PM (Q/rld)

254 Funny...., but these days might make you a party in the subsequent child support litigation.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 07:25 PM (F2IAQ)


I wasn't proposing to give them one that was loaded.

Posted by: Jay Guevara at April 24, 2015 07:29 PM (oKE6c)

255 Her parents are standing by her:

http://goo.gl/GD1oOk

What they are all doing which is a common prog trait: what they cant achieve legally, they will achieve extra judicially. Courts wont touch this bullshit so we will force the university to punish him. It's despicable.

Posted by: Bruce J. at April 24, 2015 07:30 PM (iQIUe)

256 kukubananas.

put all your troubles behind you

shed not a sympathy tear

the crazy ones, they will stalk you

and find yourself in arrears

Posted by: seamrog at April 24, 2015 07:30 PM (bZG+P)

257 and find yourself in arrears
Posted by: seamrog at April 24, 2015 07:30 PM (bZG+P)

ISWYDT.

Posted by: Jay Guevara at April 24, 2015 07:31 PM (oKE6c)

258 Ludwig, nah a natural progression. She converted later in life, post Sharpton Circus of Hate and Litigation.

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:31 PM (lQHc1)

259 TCM has Forbidden Planet on at 8.

Posted by: steevy at April 24, 2015 07:32 PM (mGBKM)

260 23 she's pretty much made herself unemployable except for government or academia.
Posted by: X at April 24, 2015 06:19 PM (n5fTN)


That's not a problem. Those will be the only jobs left in a few years.

Posted by: rickl at April 24, 2015 07:32 PM (sdi6R)

261 If ace is going out tonite, somebody needs to go with im as a chaperone.

Posted by: Bruce J. at April 24, 2015 07:33 PM (iQIUe)

262 She converted later in life, post Sharpton Circus of Hate and Litigation.
Posted by: Anna Puma (+SmuD)

So is she a real mohammedan or the fake Calypso Louis variety?

Posted by: Prince Ludwig the Indestructible at April 24, 2015 07:33 PM (Q/rld)

263 Her parents need to ask themselves why they didn't recognize and try and address her hysterical and attention seeking behavior, and why she uses sex as currency

Posted by: ThunderB at April 24, 2015 07:34 PM (zOTsN)

264 Changing the topic, I never did see Forbidden Planet.

A couple weekends ago I *did* read The Tempest for the first time. All this time I thought Shakespeare's comedies weren't good. The Tempest gets around that by being REALLY FREAKING SCARY. Yes, it has jokes... on the surface.

Posted by: boulder terlit hobo at April 24, 2015 07:35 PM (W540W)

265 Prospero in this era would be a college administrator.

Posted by: boulder terlit hobo at April 24, 2015 07:36 PM (W540W)

266 264 Forbidden Planet is worth watching for Ann Francis alone.

Posted by: steevy at April 24, 2015 07:36 PM (mGBKM)

267 Girls are so stupid. I guess their moms never told them that the guy who wants do you up the butt is never going to marry you.

Posted by: L, Elle at April 24, 2015 07:36 PM (2x3L+)

268 I will not stand idly by as smears of this girl fly

Posted by: Try Depends new Magnum series for manmade incontinence at April 24, 2015 07:37 PM (jT+gh)

269 Ludwig - Considering how bonkers both are, I never bothered to find out what flavor of crazy.

ThunderB - They could never ask those kinds of questions without calling into question their own beleifs and egos. Which means they would be as successful as Dr. Morbius yelling "I give you up!"

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:37 PM (lQHc1)

270 I looked up sulkowitcz's image. Not that attractive to me.

Posted by: Ronster at April 24, 2015 07:37 PM (4NtAn)

271 Imagine lecturing to a class that had Sulkowicz in it, where any inadvertent double entendres start a wave of suppressed sniggering.


"So the bottom line is ..."

"You in the back ... yes, please take a seat ..."

"It's important not to get behind in your work ..."

"In this lecture, we'll consider the successor to the Long Parliament, known commonly as the "Rump Parliament."


It'd be a lecturer's nightmare.

Posted by: Jay Guevara at April 24, 2015 07:39 PM (oKE6c)

272 Forbidden Planet is worth it for the design work.

Posted by: Pappy O'Daniel at April 24, 2015 07:39 PM (YvRAm)

273 "Uh, your mattress won't fit in the normal doors... could you take it through the rear?"

Posted by: boulder terlit hobo at April 24, 2015 07:40 PM (W540W)

274 The University of Tübingen was probably a better choice.

Posted by: FenelonSpoke at April 24, 2015 07:40 PM (DXzRD)

275 yes, her emotional problems are deep seated

Posted by: seamrog at April 24, 2015 07:41 PM (bZG+P)

276 Really push the Modern Feminists into cray-cray mode, mention the fact that the tonalities used in Forbidden Planet were co-created by a woman. Yeah a woman in the 1950s US creating electronic music for a major motion picture.

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:42 PM (lQHc1)

277 Forbidden planet with a $1.9 million budget,reputedly $125,000 for Robbie the Robot alone.

Posted by: steevy at April 24, 2015 07:42 PM (mGBKM)

278 18
That's where most rapes take place, right, on a pinball machine?
Posted by: Soothsayer, Inc. -- The King Unwilling at April 24, 2015 06:18 PM (Tk6Z0)

Damn hard to carry around a pinball machine though.

Posted by: Insomniac at April 24, 2015 07:42 PM (mx5oN)

279 275 yes, her emotional problems are deep seated

Posted by: seamrog at April 24, 2015 07:41 PM (bZG+P)



But it wasn't until college that they reared up.

Posted by: Jay Guevara at April 24, 2015 07:43 PM (oKE6c)

280 I looked up sulkowitcz's image. Not that attractive to me.
Posted by: Ronster at April 24, 2015 07:37 PM (4NtAn)


Me either

Posted by: Fred the Wonder Dog at April 24, 2015 07:43 PM (V+kmg)

281 From the waist down she looked pretty good.

Posted by: Assault Penis at April 24, 2015 07:44 PM (F0Cog)

282 "Just to settle a bet, does anybody actually do any academic work at university any more?"

That probably isn't news. Students in math class learning Calculus isn't news. Chemistry class might be news if you can tie it into "Breaking Bad" or pipe bombs.

It's just like the bazzillions of cars on the roads and bridges of American who don't get into an accident. Where is the news in that?

Posted by: Gander Lander at April 24, 2015 07:44 PM (DsP0g)

283 Wow, that woman is pure evil.

Posted by: Null at April 24, 2015 07:45 PM (xjpRj)

284 Girls are so stupid. I guess their moms never told them that the guy who wants do you up the butt is never going to marry you.
Posted by: L, Elle at April 24, 2015 07:36 PM (2x3L+)



::: shifty eyes :::

Dunno. Maybe.

Posted by: Sean Bannion at April 24, 2015 07:45 PM (V+kmg)

285 I read the lawsuit. Shame the only thing that stuck out to me was they had oral sex AFTER having anal and vajayjay sex. To each his own I guess.

Posted by: Cruzinator at April 24, 2015 07:45 PM (P7ulB)

286 the text of the lawsuit is em bare assing.

Posted by: seamrog at April 24, 2015 07:46 PM (bZG+P)

287 Anal? That's so 80's. You've got to let a guy pee on you these days in order to keep him.

Posted by: Annie Sprinkle at April 24, 2015 07:46 PM (Eszro)

288 285 Ass to mouth.

Posted by: steevy at April 24, 2015 07:46 PM (mGBKM)

289 267 Girls are so stupid. I guess their moms never told them that the guy who wants do you up the butt is never going to marry you.
Posted by: L, Elle at April 24, 2015 07:36 PM (2x3L+)

Could be a selling point, you never know.

Posted by: Insomniac at April 24, 2015 07:46 PM (mx5oN)

290 Yeah

I guy who goes anal, to vaginal, and wants a blow job? In that order?

Does not care about you.

Posted by: ThunderB at April 24, 2015 07:47 PM (zOTsN)

291 The quality of the double entendres have bottomed out.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 07:47 PM (Q/rld)

292 "I looked up sulkowitcz's image. Not that attractive to me.
"

Yeah, but have you seen her anus?

Posted by: ccoffer at April 24, 2015 07:47 PM (/I1ti)

293 "Uh, your mattress won't fit in the normal doors... could you take it through the rear?"

When I played a lot of softball, 2 teams we could never beat were " Liquor in Front, Poker in the Rear" and FUBAR.

Posted by: johnny yuma at April 24, 2015 07:48 PM (ahBY0)

294 Sneaking out in the a.m. Without being detected?

Why that's right out of the Claven manual, I tells ya!

Posted by: Cliff "Big Shooter" Claven at April 24, 2015 07:48 PM (fxN9x)

295 I stabbed her first. With my dick! I did all three holes, in an order that might surprise you!

Posted by: Batman at April 24, 2015 07:48 PM (mx5oN)

296 Brawley's family said she does not wear a hijab, or head scarf, but is a devout Muslim, a conversion that began during the trial when Nation of Islam leader Louis Farrakhan gave her the name Maryam Muhammad.

Posted by: FenelonSpoke at April 24, 2015 07:48 PM (DXzRD)

297 Where this will go is that everyone, everywhere, will be covered in body cameras at all times just to prevent this kind of thing.

Posted by: Null at April 24, 2015 07:48 PM (xjpRj)

298 Emma Royd (thanks, moron!) found the one German exchange student who initially DIDN'T want to do it in the butt. Unlucky her

Quote from pdf "eehm / maybe not? / jk / I miss your face tho"

Posted by: boulder terlit hobo at April 24, 2015 07:49 PM (W540W)

299
Rape Friday?


I still think the Super volcano went to the prom with it's aunt Krakatoa.

Posted by: eleven at April 24, 2015 07:49 PM (MDgS8)

300 Fisting's retro and gonna comeback bigger than ever!

Posted by: Candy striper at April 24, 2015 07:49 PM (jT+gh)

301 If her mentor was Farrakook, she's not a Muslim, observant or not

Posted by: boulder terlit hobo at April 24, 2015 07:49 PM (W540W)

302 What what?

Posted by: Samwell at April 24, 2015 07:49 PM (mx5oN)

303 Does this mattress make my ass look fat?

Posted by: Afroman at April 24, 2015 07:50 PM (uTc5j)

304 When it says 'they had oral sex' I took that to mean mutual. Either way not my cup of tea.

Posted by: Cruzinator at April 24, 2015 07:50 PM (P7ulB)

305 Being old school myself, this anal stuff sounds disgusting. Guess I'll never know. Bandersnatch says it's good.

Posted by: Ronster at April 24, 2015 07:51 PM (4NtAn)

306 Does this mattress make me look like social outcast?

Posted by: eleven at April 24, 2015 07:51 PM (MDgS8)

307 I was gonna hang up my dorm room drapes
Then I got high
Accused a bunch of guys of rape
Then I got high
Now I carry my mattress around and I know why
Cause I got high
Cause I got high
Cause I got high

Posted by: Emma Afroman Sulkowicz at April 24, 2015 07:52 PM (mx5oN)

308 pdf: anal as part of foreplay. that is a highway to a UTI

Posted by: boulder terlit hobo at April 24, 2015 07:52 PM (W540W)

309 Girls are so stupid. I guess their moms never told them that the guy who wants do you up the butt is never going to marry you.
Posted by: L, Elle at April 24, 2015 07:36 PM (2x3L+)
---
Tonight on a very special "Saved By the Bell"...

Posted by: All Hail Eris at April 24, 2015 07:52 PM (KH1sk)

310 The guy described anal as "foreplay"

I find that curious

Posted by: ThunderB at April 24, 2015 07:52 PM (zOTsN)

311 This is a ckufed up situation, but after reading those Facebook messages Paul should go by the name Cuck Nungesser.

Cuz that's definitely in his future.

Dude doesn't understand women.

Posted by: Dack Thrombosis at April 24, 2015 07:53 PM (oFCZn)

312 308 pdf: anal as part of foreplay. that is a HERSHEY highway to a UTI
Posted by: boulder terlit hobo at April 24, 2015 07:52 PM
(W540W)

FTFY

Posted by: Insomniac at April 24, 2015 07:53 PM (mx5oN)

313 Farrakahn and his Fruits of Islam is about as legit as Yahweh ben Yahweh and his merry crew of thugs.

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:53 PM (lQHc1)

314 I hope Columbia and that lying bitch get what they have coming to them.

There, I said it.

Posted by: WannabeAnglican at April 24, 2015 07:54 PM (/l3Yp)

315 The guy described anal as "foreplay"

I find that curious
Posted by: ThunderB at April 24, 2015 07:52 PM (zOTsN)
---
Should be "aftplay".

And when the heck did buttsecks become the coming thing? Why, if one has a perfectly good cooch, would that hold any appeal?

Posted by: All Hail Eris at April 24, 2015 07:55 PM (KH1sk)

316 She's doable...if not for that whole batshit crazy thing.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 07:55 PM (F0Cog)

317 288 285 Ass to mouth.

Posted by: steevy at April 24, 2015 07:46 PM (mGBKM)



Yeah? What's your point?

Posted by: Allison Williams at April 24, 2015 07:55 PM (oKE6c)

318 313 Farrakahn and his Fruits of Islam is about as legit as Yahweh ben Yahweh and his merry crew of thugs.

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:53 PM (lQHc1)



The Fruits of Islam better stay away from Iran, if they know what's good for them.

Posted by: rickl at April 24, 2015 07:56 PM (sdi6R)

319 what america needs is more illegals to help stem this campus rape crisis

Posted by: joe-impeachin44 at April 24, 2015 07:56 PM (bCJvd)

320 Vagina to @ss to mouth, then Hep C?

Tatoo parlor. H8ER.

Posted by: Pam Anderson at April 24, 2015 07:56 PM (xQX/f)

321 He won't win. His life is ruined. The only thing that will stop leftists from defaming
others is if a few of them end up with their tongues cut out. Not even sure that will work.

Posted by: Naes at April 24, 2015 07:57 PM (YhayY)

322 Should be "aftplay".



On the poop deck?



And when the heck did buttsecks become the coming thing? Why, if one has a perfectly good cooch, would that hold any appeal?

Posted by: All Hail Eris at April 24, 2015 07:55 PM (KH1sk)

I can't figure that out either. It's like being into having people throw up on you.

Posted by: Jay Guevara at April 24, 2015 07:57 PM (oKE6c)

323 What sucks about the PDF isn't just how Jane Doe #1 totally LIED about being sexually assaulted. It's also how Jane Doe #2 retroactively called JPN a cad who only cared about sex. In an affidavit.

Jane Doe #2's comments would be actively heartbreaking even if told outside a criminal complaint.

Posted by: boulder terlit hobo at April 24, 2015 07:58 PM (W540W)

324 And when the heck did buttsecks become the coming thing? Why, if one has a perfectly good cooch, would that hold any appeal?
Posted by: All Hail Eris

Here's Cheyenne Cinnamon to explain: https://youtu.be/8FipgjakTGA

Posted by: Prince Ludwig the Indestructible at April 24, 2015 07:58 PM (Q/rld)

325 Don't forget the salad!!

Posted by: Tossed at April 24, 2015 07:58 PM (uTc5j)

326
Aft play?


The judges give it 8's all around.

Except for the Russian judge.

He's a dick.

Posted by: eleven at April 24, 2015 07:59 PM (MDgS8)

327 Oh well time to root for the Monster of the Id.

Posted by: Anna Puma (+SmuD) at April 24, 2015 07:59 PM (lQHc1)

328 Not clicking on that link, Ludwig. No way.

Posted by: All Hail Eris at April 24, 2015 07:59 PM (KH1sk)

329 The guy described anal as "foreplay"

Que Inigo Montoya meme...

Posted by: Tilikum Killer Assault Whale at April 24, 2015 07:59 PM (F0Cog)

330
Oh well time to root for the Monster of the Id.


The Krell were perfect in every way....



except for one way.

They wouldn't do anal.

Posted by: eleven at April 24, 2015 08:00 PM (MDgS8)

331 PP 20: "She messaged Paul that she had tested positive for an STD after having had sex at a party "with both John Doe and his best friend Joe."


This girl's a real prize.

Posted by: Jay Guevara at April 24, 2015 08:01 PM (oKE6c)

332 And neither would Ann Francis.

Posted by: eleven at April 24, 2015 08:01 PM (MDgS8)

333 pdf: anal as part of foreplay. that is a highway to a UTI
Posted by: boulder terlit hobo at April 24, 2015 07:52 PM (W540W)

*******
I hear she got them all the time. That's why they call her CUTI.

Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 08:02 PM (3F6F8)

334 The Krell were perfect in every way....



except for one way.

They wouldn't do anal.

Posted by: eleven
****

Quite the opposite. They would ONLY do anal. Hence their extinction.
The Id monsters were a red herring.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:02 PM (F0Cog)

335 "Inigo Montoya meme"

You reamed her. You left her. You stained her mattress!

Posted by: boulder terlit hobo at April 24, 2015 08:02 PM (W540W)

336 lol

Posted by: SMFH at it all at April 24, 2015 08:02 PM (OsWis)

337 I grew up in a mostly Catholic area and the family of the few girls who got pregnant moved out of shame. Needless to say, the girls developed certain "ahem" skills to avoid such. I do miss those days.

Posted by: johnny yuma at April 24, 2015 08:02 PM (ahBY0)

338 What a wimp. I bet I could carry that mattress over my head with one hand. She needs to eat her Wheaties. A balanced diet is an important part of a healthly mind.

Posted by: Bruce Jenner at April 24, 2015 08:03 PM (cIoI4)

339 The Krell were perfect in every way....



except for one way.

They wouldn't do anal.
Posted by: eleven at April 24, 2015 08:00 PM (MDgS



All they did was have anal.

They had 37 anuses.



But no mouth.



And no cooter.


And 36 penises.


So....a reach around every time.

Posted by: naturalfake at April 24, 2015 08:03 PM (KUa85)

340 This girl's a real prize.


Posted by: Jay Guevara
****

What's the problem? It's not like you can catch anything fatal thru unprotected sex. /

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:03 PM (F0Cog)

341 who's sulking now?

Posted by: adams and hawkeye are my favorites at April 24, 2015 08:04 PM (VpUs/)

342 Theres a girl walking around a College Campus with a mattress that says she was raped?

I thought she worked for Downers Furniture advertising the semi yearly "going out of business sale"

Does she give out free onions?

Posted by: Luap Nor's last brain cell at April 24, 2015 08:04 PM (U7H1n)

343 I was going to butt in,

butt realized "it's none of my business"

Posted by: seamrog at April 24, 2015 08:04 PM (Lo0IM)

344 "... and left a brown stain on the mattress! I think you been cheated!"

Posted by: R. Lee Ermey 20 years from now at April 24, 2015 08:05 PM (oKE6c)

345 Beaten to the punch.

*shakes fist*


Damn you, you crafty cetacean.

Posted by: naturalfake at April 24, 2015 08:05 PM (KUa85)

346 One plus for her- she supplies the mattress for sex! /

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:05 PM (F0Cog)

347 Forbidden Planet also an early use of synthesizer music.They called it " electronic tonalites" because the studio music department objected to calling it music.

Posted by: steevy at April 24, 2015 08:05 PM (mGBKM)

348 I just got here so this may have been mentioned, but...the *German* dude had no experience with anal, and had to be asked to dork the squeaker?

I find that to be the most confusing part of the story.

Posted by: DC in River City, temporary bachelor at April 24, 2015 08:06 PM (e+1S5)

349 Anyone here remember the "doorknob" analogy?

Everyone gets a turn.

Posted by: seamrog at April 24, 2015 08:06 PM (Lo0IM)

350 They used to call that mattress "Emma's Crab Shack"

Posted by: boulder terlit hobo at April 24, 2015 08:06 PM (W540W)

351 What's the problem? It's not like you can catch anything fatal thru unprotected sex. /

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:03 PM (F0Cog)

Read para. 21.
Yow.

Posted by: Jay Guevara at April 24, 2015 08:06 PM (oKE6c)

352 This girl's a real prize.


Posted by: Jay Guevara at April 24, 2015 08:01 PM (oKE6c)



Given her parentage, she speaks volumes for the value of psychiatry.

Posted by: Bob's House of Flannel Shirts and Wallet Chains at April 24, 2015 08:07 PM (yxw0r)

353 Most people just have no shame anymore.

Posted by: jewells45 trying to keep from going crazy at April 24, 2015 08:07 PM (/IQip)

354 267 Girls are so stupid. I guess their moms never told them that the guy who wants do you up the butt is never going to marry you.
Posted by: L, Elle at April 24, 2015 07:36 PM (2x3L+)

The strange thing is she is the one who wanted the butt sex. He seemed reluctant - he told he he had no experience playing the B side, as we used to call it.

No anal fixation? Is this guy really a kraut?

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:07 PM (+XMAD)

355 Damn you, you crafty cetacean.



Posted by: naturalfake
****

I have my lucid moments.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:07 PM (F0Cog)

356 Eve of destruction,
tax deduction,
solid gold in demand,
population out a hand ...

Posted by: Adriane the Cynic ... at April 24, 2015 08:08 PM (nSOh+)

357 Nothing says 'healthy mind' quite the same as your junk floating in a bell jar.

Posted by: Rasputin at April 24, 2015 08:08 PM (xQX/f)

358 speaking of that "cheeky" Game of Thrones ref... that episode, where the Mountain meets Oberyn Martell, is on the RP slate for a Hugo.

So, if you bought a supporting WSFS membership this year, you can vote for it.

Posted by: boulder terlit hobo at April 24, 2015 08:08 PM (W540W)

359 She should've forgotten the anal and offered him-


one of those Little Caesar's Bacon-wrapped Deep Dish Pepperoni Pizzas.


They'd be happily married today.

Posted by: naturalfake at April 24, 2015 08:08 PM (KUa85)

360 Only a german would think of anal as foreplay

Posted by: ThunderB at April 24, 2015 08:09 PM (zOTsN)

361 The just part of this pitiful saga is that she caught an STD and no guy in his right mind will want to touch her. She'll wind up with a crazy loser who has the same disease she does or will turn to lesbianism bc she will blame her misery on men and ultimately decide that all me are evil.

Posted by: L, Elle at April 24, 2015 08:09 PM (2x3L+)

362 l, elle: all me are evil

Well, men, but also you since you don't hate men. Maybe even more you.

Posted by: boulder terlit hobo at April 24, 2015 08:10 PM (W540W)

363 I've always found mattresses awkward to carry when moving into a new house. So I guess I'm wondering if her mattress is king or queen sized.
Oh and how come anybody still enrols in college?

Posted by: Northernlurker at April 24, 2015 08:10 PM (nlHrF)

364 Cookie - "Nothing to do except throw rocks at tin cans. And we got to bring our own tin cans."

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:11 PM (lQHc1)

365 Reading that they had anal, vag and then oral sex kinda put me off my dinner. If you're gonna aim for every orifice, that sequence should be reversed.

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:11 PM (+XMAD)

366 It was a dorm mattress. Cheap.

Posted by: ThunderB at April 24, 2015 08:12 PM (zOTsN)

367 To borrow an image from Sartre's "No Exit", I think Hell would be confinement in a room for all eternity with Emma Sulkowicz and Elle Mallon. For me, that is. They're already living in their own private hells.

Posted by: Sunni LeBeouf at April 24, 2015 08:12 PM (XrHO0)

368 Umm, like, she was all unconscious and stuff. Puked all over.
I still did her bruh.

Posted by: John Doe at April 24, 2015 08:12 PM (F0Cog)

369 Ball of Confusion

Posted by: johnny yuma at April 24, 2015 08:12 PM (ahBY0)

370 Just read the complaint. What a despicable, lying, diseased slut that mattress woman is.

I hope the guy gets a big enough settlement from Columbia to never have to work again in his life.

And I hope his sleazy, spurned ex's life is filled with the same kind of misery she has heaped on him these past few years.

Nasty scrunt.

Posted by: TrivialPursuer at April 24, 2015 08:12 PM (lmdHn)

371
So, why does Drudge have Bruce's name crossed out?

Posted by: Bruce J. at April 24, 2015 08:13 PM (iQIUe)

372 There are a bunch of STDs that can eventually lead to cancer. I hope she gets a colonoscopy soon.

Posted by: @votermom at April 24, 2015 08:13 PM (cbfNE)

373 Reading that they had anal, vag and then oral sex kinda put me off my dinner. If you're gonna aim for every orifice, that sequence should be reversed.

Posted by: Donna &&&&&& V. (brandishing ampersands)
****

One would hope there was an unmentioned shower in between.

Posted by: John Doe at April 24, 2015 08:13 PM (F0Cog)

374 Thanks for catching my typo, terlit.

Posted by: L, Elle at April 24, 2015 08:14 PM (2x3L+)

375 Doesn't A and then V risk some sort of lady infection? A then O risks cholera and about a dozen other diseases.

Posted by: Naes at April 24, 2015 08:14 PM (YhayY)

376 war on wymyn!

Posted by: redc1c4 at April 24, 2015 08:14 PM (pZtrP)

377 As far as I am concerned that hole is exit only.

Posted by: steevy at April 24, 2015 08:15 PM (mGBKM)

378 Sure. Because college students are known for their scrupulous hygiene

Posted by: ThunderB at April 24, 2015 08:15 PM (zOTsN)

379 As an FSU graduate and fan, I have followed the Jameis Winston saga closely. This situation parallels the Winston situation in many ways. Anyone who thinks Winston is guilty is either ignorant (hasn't read the documents) or stupid (has read the documents and can't understand them.) His accuser changed her story 4 times throughout the ordeal and Winston was cleared by a student body hearing chaired by a Florida Supreme Court Justice chosen by the accuser. She is now appearing in the movie "The Hunting Grounds" to tell her loony story.
I feel for men who attend college in these times. ANY contact with a woman can turn into a nightmare for them if the woman changes her mind or has buyer's remorse.

Posted by: Paul at April 24, 2015 08:16 PM (5942m)

380 She did John Doe and his best friend...at the same time?

Posted by: John Doe at April 24, 2015 08:16 PM (F0Cog)

381 Watching Forbidden Planet. These planetscapes are feeling very Chesley Bonestallish.

Retrofuturism much cooler than the iPresent.

Posted by: All Hail Eris at April 24, 2015 08:16 PM (KH1sk)

382 Posted by: L, Elle at April 24, 2015 08:09 PM (2x3L+)

She'll be a star at that crazy rad fem site where they go on about PIV sex and want almost all males aborted/killed.

If he is awarded big bucks (and I hope he is), she'll really go off the deep end. She'll spend the rest of her life talking to other insane women about how our sexist society rewards rapey rapists.

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:16 PM (+XMAD)

383 Off retarded, rapist, sock.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:16 PM (F0Cog)

384 Doesn't A and then V risk some sort of lady infection? A then O risks cholera and about a dozen other diseases.
Posted by: Naes

Is that what that movie "Love in the Age of Cholera" was about? I didn't see it.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 08:16 PM (Q/rld)

385 Columbia University is an Ivy League school with an acceptance rate of less than 7% and still they manage to srlect the crazies.

Posted by: @votermom at April 24, 2015 08:17 PM (cbfNE)

386 One would hope there was an unmentioned shower in between.
Posted by: John Doe at April 24, 2015 08:13 PM (F0Cog)

One hopes.

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:17 PM (+XMAD)

387 Rape culture indeed. Thanks to Rolling Stone, Senator Gillabrand, Columbia U, and the media.

Posted by: california red at April 24, 2015 08:17 PM (UyEG4)

388 I certainly hope that in the prayer for relief of the complaint that he asks to get to fuck her again.

All is fair in fake rape litigation, after all.

Posted by: Sharkman at April 24, 2015 08:17 PM (wsMk3)

389 There are a bunch of STDs that can eventually lead to cancer. I hope she gets a colonoscopy soon.

Posted by: @votermom at April 24, 2015 08:13 PM (cbfNE)


She was apparently unaware that sphincter spelunking - as an alternative to protected PIV sex - is considered to be the main reason that sub-Saharan Africa has such a problem with heterosexual AIDS.

Posted by: Jay Guevara at April 24, 2015 08:18 PM (oKE6c)

390 steevy: yeah, never seen the appeal of the pink starfish. i dated one girl who was into that. she didn't get it.

when i hear that my initial thought is that there might be a prostate gland hiding up there.

Posted by: boulder terlit hobo at April 24, 2015 08:18 PM (W540W)

391 It used to be an insult to tell someone to "stick it up your ass." Now, chicks want to stick things in their asses.

We're going to be talking about anal until the ONT. Geesh.

Posted by: L, Elle at April 24, 2015 08:18 PM (2x3L+)

392 Anal and THEN vag?? Fucking gross. And open to every infection possible. Just. Yuk.

Posted by: jewells45 trying to keep from going crazy at April 24, 2015 08:18 PM (/IQip)

393 As an FSU graduate and fan, I have followed the Jameis Winston saga closely. This situation parallels the Winston situation in many ways. Anyone who thinks Winston is guilty is either ignorant (hasn't read the documents) or stupid (has read the documents and can't understand them.) His accuser changed her story 4 times throughout the ordeal and Winston was cleared by a student body hearing chaired by a Florida Supreme Court Justice chosen by the accuser. She is now appearing in the movie "The Hunting Grounds" to tell her loony story.
I feel for men who attend college in these times. ANY contact with a woman can turn into a nightmare for them if the woman changes her mind or has buyer's remorse.


Posted by: Paul
****
Ees all about the cause, comrade.

Posted by: Communist Guy at April 24, 2015 08:18 PM (F0Cog)

394 Yeah, that whole thing in the .pdf about anal, vaginal, and then oral sex? In that order? I believe they're doing it wrong.

Posted by: Fritz at April 24, 2015 08:19 PM (ty633)

395 As my bestie is fond of saying.. that is an exit only honey.

Posted by: jewells45 trying to keep from going crazy at April 24, 2015 08:19 PM (/IQip)

396 Woman texts you to f her in the butt you should not, NOT, go near her. You, dude, aren't that special. She's already on guy 200. You'd be safer with a prostitute.

Posted by: dick cheney at April 24, 2015 08:20 PM (hTeQK)

397 This is a girl who had condom free sex with "john doe" in the hopes he would wear a condom with everyone else. And then got an STD. And says she drunk fucked his friends.

German dude. Duuuuude


Anal with that?

Posted by: ThunderB at April 24, 2015 08:20 PM (zOTsN)

398 Never done backdoor either. If I told you one reason why you'd accuse me of bragging.
The main reason tho- eeewww.

Posted by: Communist Guy at April 24, 2015 08:21 PM (F0Cog)

399 385 Columbia University is an Ivy League school with an acceptance rate of less than 7% and still they manage to srlect the crazies.

Posted by: @votermom at April 24, 2015 08:17 PM (cbfNE)



Yep. It's tough weeding out the sane applicants, but somehow they manage.

Posted by: Jay Guevara at April 24, 2015 08:21 PM (oKE6c)

400 381, ERS - Ah, Chesley B. and Strombecker space stations.

And no, I can't imagine going to college today.

Posted by: Skookumchuk at April 24, 2015 08:21 PM (/WPPJ)

401 I don't understand why the sociopathic mattress lumper wasn't named in the lawsuit.

Posted by: Dion at April 24, 2015 08:22 PM (Um5Y5)

402 Posted by: Paul at April 24, 2015 08:16 PM (5942m)

I'll give him the benefit of the doubt on the rape accusation but he's not some fine upstanding citizen.

Posted by: Cruzinator at April 24, 2015 08:22 PM (P7ulB)

403 These socks are harder to take off then a condom.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:22 PM (F0Cog)

404 All Hail Eris, and the future was far more positive. Man escaped the Solar System and did Manifest Destiny.

So is Dr. Morbius a 'mad scientist of the tape thriller' or not?

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:23 PM (lQHc1)

405 Don't send your son to college without me!

Posted by: GoPro at April 24, 2015 08:23 PM (yxw0r)

406 Maybe it would benefit everyone if parents told thier children that sex is not as inconsequential as blowing your nose

Posted by: ThunderB at April 24, 2015 08:23 PM (zOTsN)

407 So, why does Drudge have Bruce's name crossed out?

Posted by: Bruce J. at April 24, 2015 08:13 PM (iQIUe)

*********

Meh, Bruce, that's just Drudge being a tease. No real info until the interview.

This is just like that Monty Python Aussie skit. Bruce, Bruce and Bruce.

Posted by: Bruce Jenner at April 24, 2015 08:24 PM (cIoI4)

408 Maybe it would benefit everyone if parents told thier children that sex is not as inconsequential as blowing your nose

Posted by: ThunderB
****

Stop being so logical.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:24 PM (F0Cog)

409 I made it about 60% of the way through the excellent Complaint, and one of the scariest parts to me is a relative footnote to the story, in the second friend of Miss Crazy who filed a claim against John-Paul N. to the effect that he'd "refused to see her unless she had sex with him."

There was apparently some convoluted finding that he didn't, in fact, engage in that activity. But what is amazing to me is that such an "allegation" would even, if 100% true, merit any response but "whaaat?" and slowly backing away.

Unless the door is locked or the person is holding a weapon, how can anyone be "coerced" by whatever condition someone would want to attach to a voluntary relationship? Oh you don't want to polish my knob? Well you can't hang out with me. You are free to polish or vanish as you wish.

Posted by: NYC Parent at April 24, 2015 08:24 PM (v/Mqc)

410 Didn't anyone give him the talk? The talk: "Son, don't fuck crazy ladies

(especially those in college) [especially art students]. Steer clear. I know they're easy pickings but they will find a way to make you miserable. FOREVER.
Use hookers if you
can't
control your urges."

Posted by: Naes at April 24, 2015 08:24 PM (YhayY)

411 This is just like that Monty Python Aussie skit. Bruce, Bruce and Bruce.


Posted by: Bruce Jenner
****

Spam, spam, spam...

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:25 PM (F0Cog)

412 404 Spread the disease of mankind to the stars to defile the environments of other worlds.

Posted by: steevy at April 24, 2015 08:25 PM (mGBKM)

413
This whole sorry episode is an object lesson in keeping clear separation between Dick and Crazy.

Both of Ms Sulkowitcz's parents are psychiatrists in NYC. Both are MD's and wrote an open letter to Columbia last year complaining that the school didn't do enough. I don't think they had read her emails.

Posted by: Lester at April 24, 2015 08:26 PM (2UPXV)

414 Didn't anyone give him the talk? The talk: "Son, don't fuck crazy ladies

(especially those in college) [especially art students]. Steer clear. I know they're easy pickings but they will find a way to make you miserable. FOREVER.
Use hookers if you
can't
control your urges."

Posted by: Naes
****

Ummm yeah, because hookers are....better.... o_O /

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:26 PM (F0Cog)

415 The ironic thing is this German dude was raised by lefty/feminist parents in Berlin and it sounds like he was as PC as they come (who else gets admitted to Columbia these days?)

I hope he wins a fortune, but I have to wonder - if Crazy Ass (in all respects) had fallen for and accused another guy, would Jean-Paul be one of her White Knights, threatening the guy on Twitter and Facebook and shunning him in person?

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:26 PM (+XMAD)

416 If I was an alien intelligence and the Social Justice Wankers looked poised to escape the Solar System, I would pot the whole enchilada right down the nearest Black Hole.

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:26 PM (lQHc1)

417 288 Ass to mouth.

Posted by: steevy at April 24, 2015 07:46 PM (mGBKM)


If there weren't a vag breaking up the workflow in this particular scenario, I would be thoroughly appalled.

Posted by: Dante Hicks at April 24, 2015 08:28 PM (l3LvV)

418 Reading the complaint makes clear that university administrators, Facebook, art faculty, and of course Kirsten Gillibrand are ALL worthless.

Posted by: Jay Guevara at April 24, 2015 08:28 PM (oKE6c)

419 If I was an alien intelligence and the Social Justice Wankers looked poised to escape the Solar System, I would pot the whole enchilada right down the nearest Black Hole.

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:26 PM (lQHc1)


Or-

Orrrrrrrr


You'd have anal with all of them.

Posted by: naturalfake at April 24, 2015 08:29 PM (KUa85)

420 Maybe it would benefit everyone if parents told thier children that sex is not as inconsequential as blowing your nose

You can't get Obama phone, food stamps and disability by blowing your nose or anything else for that matter. One generation and it's all gone.

Posted by: johnny yuma at April 24, 2015 08:29 PM (ahBY0)

421 I would pot the whole enchilada right down the nearest Black Hole.

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:26 PM (lQHc1)




Ooh, go on ...

Posted by: Emma Sulkowicz at April 24, 2015 08:30 PM (oKE6c)

422 Alternate headline: Cum Dumpster with Loose Asshole Regrets the World Knowing That She is a Cum Dumpster with Loose Asshole.

This git needs to pay up, her parents need to pay up, the school needs to pay up, and the wronged fellow needs to never have to work a day in his life.

Her parents must be so proud of her, sleeping around and taking it up the bum so much. Very proud, indeed.

Posted by: tcn in AK at April 24, 2015 08:30 PM (+YMhA)

423 *gags*

Social Justice Wankers, a worse scourge upon the space lanes than Spaceballs.

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:30 PM (lQHc1)

424 So he plans to give it to the university in the ass this time.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:30 PM (F0Cog)

425 414
Ummm yeah, because hookers are....better.... o_O /

The talk continued: "Hookers don't accuse people of rape. And if they do, no one gives a shit. The clap can be cured with antibiotics. And check for an Adam's apple before you pay. Oh, and wear a condom."

Posted by: Naes at April 24, 2015 08:31 PM (YhayY)

426 There was a trend years ago, and possibly still true today, of women (girls) doing anal-only until they really loved the guy and only then vaginally. I think that could explain the mainstreaming of butt sex. Hygiene is apparently a secondary consideration.

Posted by: Afroman at April 24, 2015 08:31 PM (uTc5j)

427 but I have to wonder - if Crazy Ass (in all respects) had fallen for and accused another guy, would Jean-Paul be one of her White Knights, threatening the guy on Twitter and Facebook and shunning him in person?
Posted by: Donna &&&&&& V. (brandishing ampersands)

All signs point to yes.

Posted by: Manic 8-Ball at April 24, 2015 08:32 PM (Q/rld)

428 424 So he plans to give it to the university in the ass this time.
Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:30 PM (F0Cog)

Bravo.

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:32 PM (+XMAD)

429 Alternate headline: Cum Dumpster with Loose Asshole Regrets the World Knowing That She is a Cum Dumpster with Loose Asshole.

This git needs to pay up, her parents need to pay up, the school needs to pay up, and the wronged fellow needs to never have to work a day in his life.

Her parents must be so proud of her, sleeping around and taking it up the bum so much. Very proud, indeed.

Posted by: tcn in AK
****

Yes we are. Net letting things like societal prudishness get in the way of truly discovering herself and empowering herself!
You bunch of patriarchal christo-fascists!

Posted by: Cum Catcher's Parents at April 24, 2015 08:32 PM (F0Cog)

430 How many crazy college whores does it take to screw in a light bulb?

Two . One to screw it in and one to apply the lube.

Posted by: Cruzinator at April 24, 2015 08:34 PM (P7ulB)

431 Where is a hyper-spatial bypass when you need one?

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:34 PM (lQHc1)

432 Her parents had to be aware of her histrionic personality. They should be ashamed for trying to deflect their responsibility for not addressing her dysfunction

Posted by: ThunderB at April 24, 2015 08:34 PM (zOTsN)

433 430 How many crazy college whores does it take to screw in a light bulb?

Two . One to screw it in and one to apply the lube.

Posted by: Cruzinator at April 24, 2015 08:34 PM (P7ulB)




No, three: one to extract the light bulb from the other one's ass.

Posted by: Jay Guevara at April 24, 2015 08:34 PM (oKE6c)

434 404 All Hail Eris, and the future was far more positive. Man escaped the Solar System and did Manifest Destiny.

So is Dr. Morbius a 'mad scientist of the tape thriller' or not?
Posted by: Anna Puma (+SmuD) at April 24, 2015 08:23 PM (lQHc1
----
This is why I'm happy the Human Wave movement is giving the finger to the SJWs in SF.

And if Star Trek has taught me anything, it's that mellifluous Shakespearian actors are inherently eeevil.

Posted by: All Hail Eris at April 24, 2015 08:36 PM (KH1sk)

435 Going to the mattresses... she's doing it wrong.

Posted by: Clemenza at April 24, 2015 08:36 PM (1FyZ2)

436 [i432 Her parents had to be aware of her histrionic personality. They should be ashamed for trying to deflect their responsibility for not addressing her dysfunction

Posted by: ThunderB at April 24, 2015 08:34 PM (zOTsN)



Imagine the scene over the Sulkowicz breakfast table: "Oh, look honey, the whole world now knows our little girl loves to take it up the keister, and is a disease-ridden drunken slut with mental issues. Isn't that nice?"

Posted by: Jay Guevara at April 24, 2015 08:36 PM (oKE6c)

437 Do animals do buttsecks? Or is it just us humans?

Posted by: Just some guy at April 24, 2015 08:36 PM (yxw0r)

438 Wow. I only read about half of his complaint. He's going to own Columbia U and this Sulkowicz (sp?) gal. Bitch be crazy.

Posted by: Old Blue at April 24, 2015 08:36 PM (9iR5/)

439 Hygiene is apparently a secondary consideration.
Posted by: Afroman at April 24, 2015 08:31 PM (uTc5j)

I would think pain would be an primary consideration.

This might be TMI, but girls get rectal exams at the doctor's office too - it's not any more pleasant for us than it is for straight men. So the thought of anything bigger going in there - er, no, there is an orifice that the Lord especially designed for that.

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:36 PM (+XMAD)

440 Before settling, conduct pretrial discovery to find out how much federal money Columbia received for Title IX compliance during Nunsegger's time as a student, then offer to settle for one penny less, otherwise, see you in court.

Posted by: Jack Squat Bupkis at April 24, 2015 08:37 PM (bitPb)

441 Posted by: Jay Guevara at April 24, 2015 08:34 PM (oKE6c)

All joke improvements appreciated.

Posted by: Cruzinator at April 24, 2015 08:37 PM (P7ulB)

442 Interesting similarity to Jackie. She told this guy she had been raped in high school and sexually abused by past boyfriends to gain his sympathy. Like with Randall, it worked with this guy.

I hope he wins his lawsuit, but he got played by a manipulative, lying bitch. She said enough to him that should have concerned him and made him run away, but he kept encouraging her crush and kept coming back for sex.

Posted by: L, Elle at April 24, 2015 08:37 PM (2x3L+)

443 Isn't that nice?"
Posted by: Jay Guevara at April 24, 2015 08:36 PM (oKE6c)

One has to wonder about the future of said darling girl. What, exactly, will she be qualified to do for a living, and if she DOES have a qualification, who in hell is going to hire her?

Lawsuits have consequences, as do potential lawsuits.

Posted by: tcn in AK at April 24, 2015 08:37 PM (+YMhA)

444 Imagine the scene over the Sulkowicz breakfast table: "Oh, look honey, the whole world now knows our little girl loves to take it up the keister, and is a disease-ridden drunken slut with mental issues. Isn't that nice?"


Posted by: Jay Guevara
****
(Hugs each other while tearing up)
We did it honey! We raised a dysfunctional victim!

Posted by: Cum Catcher's Parents at April 24, 2015 08:38 PM (F0Cog)

445 William Shatner is a Shakespearian actor.... there is Mirror Kirk.

And poor Christopher Plumber, went from being von Trapp to a Klingon quoting Shakespeare .

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:38 PM (lQHc1)

446 Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:36 PM (+XMAD)

Rectal exam? Watching the Brewers again Donna?

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:39 PM (o4Q38)

447 "would Jean-Paul be one of her White Knights, threatening the guy on Twitter and Facebook and shunning him in person?"

Of course. Why would you expect anything less?

Posted by: Luap Nor's last brain cell at April 24, 2015 08:39 PM (U7H1n)

448 Maybe my son will find a nice Asian chick and forget the American college girls.

Posted by: NCKate at April 24, 2015 08:40 PM (AD8xy)

449 If I had a son in college now, I think I would advise him to date the FT cashier at WalMart or a hair stylist with a degree from Beauty School - anybody but a coed.

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:40 PM (+XMAD)

450 I would think pain would be an primary consideration.

This might be TMI, but girls get rectal exams at the doctor's office too - it's not any more pleasant for us than it is for straight men. So the thought of anything bigger going in there - er, no, there is an orifice that the Lord especially designed for that.

Posted by: Donna &&&&&& V. (brandishing ampersands)
****

I remember a gay coworker at a place loaded with gay men complaining of finding a bloody tampon in a men's bathroom toilet.
But it's pleasurable they insist.
Barf.

Posted by: Cum Catcher's Parents at April 24, 2015 08:40 PM (F0Cog)

451 Thing is , she didn't know when to quit . If she would have had her little mattress game last only a few days she would have gotten away with it.

Posted by: Cruzinator at April 24, 2015 08:41 PM (P7ulB)

452 Off lunatic sock

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:41 PM (F0Cog)

453 >>One has to wonder about the future of said darling girl. What, exactly, will she be qualified to do for a living, and if she DOES have a qualification, who in hell is going to hire ------

Fucking nut cases always seem to survive. They are like cockroaches.

Don't believe me? Google Segway Boy

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:41 PM (o4Q38)

454 All that work hauling that heavy mattress around for art's sake and this is the thanks she gets? Don't you people know anything about art? It's hard.

Posted by: Milo Artbag at April 24, 2015 08:42 PM (JdEZJ)

455 Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:39 PM (o4Q3

Rectal exams are more pleasant, although I've taking a perverse interest in seeing how many different ways they can dream up to lose. A wild pitch in the 9th inning that scores a run! Now that's new!

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:42 PM (+XMAD)

456 Robby, "Sorry Miss, I was giving myself an oil job."

Posted by: Anna Puma (+SmuD) at April 24, 2015 08:42 PM (lQHc1)

457 Not too long ago, crazy people were sent to sanitariums for their own protection.

Now they are elected to legislative office and/or
highlighted in news stories.

oh... and recruited as reporters by the mfm.

(I want a time machine to go back to saner days)

Posted by: seamrog at April 24, 2015 08:42 PM (Lo0IM)

458 "would Jean-Paul be one of her White Knights, threatening the guy on Twitter and Facebook and shunning him in person?"


Cue the Groucho Marx line: "I'm defending your honor, which is more than you ever did!"

Posted by: Jay Guevara at April 24, 2015 08:42 PM (oKE6c)

459 Cue the Groucho Marx line: "I'm defending your honor, which is more than you ever did!"
Posted by: Jay Guevara at April 24, 2015 08:42 PM (oKE6c)

"Honor" is now "On Her".

Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 08:44 PM (XrHO0)

460 I think there's a larger issue that art is dead and it was raped and murdered on college campuses. Art is supposed to uplift the human experience. Dragging a mattress on your back is just a stunt. Painting in menstrual blood is just gross.

Posted by: Naes at April 24, 2015 08:44 PM (YhayY)

461 Leave the bed... take the cannoli.

Posted by: Clemenza at April 24, 2015 08:45 PM (1FyZ2)

462
Posted by: Jay Guevara at April 24, 2015 08:42 PM (oKE6c)

"Honor" is now "On Her".
Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 08:44 PM (XrHO0

I promise not to honor in your mouth

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:45 PM (o4Q38)

463 449
If I had a son in college now, I think I would advise him to date the FT
cashier at WalMart or a hair stylist with a degree from Beauty School -
anybody but a coed.

Posted by: Donna V. (brandishing ampersands) at April 24, 2015 08:40 PM (+XMAD)

************
I suspect the STEM girls are slightly less cuckoo for coco-puffs.

Posted by: Just some guy at April 24, 2015 08:45 PM (yxw0r)

464 Not too long ago, crazy people were sent to sanitariums for their own protection.

Now they are elected to legislative office and/or
highlighted in news stories.

oh... and recruited as reporters by the mfm.

(I want a time machine to go back to saner days)

Posted by: seamrog
****
Now you know why they fought for the "reform" of the mental health system. They wanted to free their people and increase their numbers.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:46 PM (F0Cog)

465 Playing now on the Interociter channel:
https://www.youtube.com/watch?v=_S_tgSVbTHs

ATC probably shouldn't click on that.

Posted by: SpongeBobSaget at April 24, 2015 08:46 PM (zauWW)

466 Does this mattress make my ass look small?

H8ers

Posted by: Emma Sulkowicz at April 24, 2015 08:46 PM (TV9BR)

467
Betcha this snowflake's parents aren't any prizes either.

Posted by: irongrampa at April 24, 2015 08:46 PM (jeCnD)

468 Maybe my son will find a nice Asian chick and forget the American college girls.
Posted by: NCKate at April 24, 2015 08:40 PM (AD8xy)
------
Plenty of knife-wielding crazies there, too.

One of my instructors had a Korean wife who didn't know he had female students. For his and our safety.

She found out and he woke up one night with a knife to his throat. She also threatened the stepkids.

I think he cycled through a Vietnamese wife before ending up with a relatively sane American one.

Posted by: All Hail Eris at April 24, 2015 08:46 PM (KH1sk)

469 ...... A wild pitch in the 9th inning that scores a run! Now that's new!
Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 08:42 PM (+XMAD

Good grief.

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:46 PM (o4Q38)

470 So these highly-selective Ivy League universities manage to select a student body that is straight out of The Aristocrats?

That explains so much about Washington, DC.

Posted by: rickl at April 24, 2015 08:46 PM (sdi6R)

471 Don't punch back twice as hard. Punch back thrice as hard.

Posted by: Thricley ad Hat at April 24, 2015 08:47 PM (0Ew3K)

472 I think ace has plopped his heiny in front of the tv so he wont miss the two hour bruce jenner tranniepalooza! I wonder if they are going to talk about cutting his dick off and making it into an artificial vagina?

Posted by: Bruce J. at April 24, 2015 08:47 PM (iQIUe)

473 Does this mattress make my ass look small?

H8ers


Posted by: Emma Sulkowicz
****

No. Your ass makes the mattress look small.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:47 PM (F0Cog)

474 I am having a personal boycott of me jenners self immolation. Rubber necking on mental illness

Posted by: ThunderB at April 24, 2015 08:48 PM (zOTsN)

475 No. Your ass makes the mattress look small.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:47 PM (F0Cog)


I would like to express sympathy for that poor mattress...

Posted by: Thricley ad Hat at April 24, 2015 08:49 PM (0Ew3K)

476 Beads..., ask her about beads...

I want to know if she is interested.

Posted by: Lisa McElroy at April 24, 2015 08:49 PM (F2IAQ)

477 Say what you will about Bruce Jenner's choice, but she's going to be one smoking hot MILF. Same with Richard Speck.

Posted by: Naes at April 24, 2015 08:49 PM (YhayY)

478 I just had to look at the comments on the WaPo article didn't I?

Posted by: Burn the Witch at April 24, 2015 08:49 PM (xSCb6)

479 I just had to look at the comments on the WaPo article didn't I?
Posted by: Burn the Witch at April 24, 2015 08:49 PM (xSCb6)

********

Thank you for taking one for the team.

Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 08:51 PM (cIoI4)

480 I think he cycled through a Vietnamese wife before ending up with a relatively sane American one.
Posted by: All Hail Eris at April 24, 2015

Buddy's son had one. Really an interesting girl. Some of the shit she ate makes you shake your head

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:51 PM (o4Q38)

481 It ended at least twenty years ago, but I miss the days when hook ups were not as common as a short make out session was back in the day. Any Tom , Dick or Harry can get laid today without any effort or game. It's unfair but I blame the women. They are supposed to be the gatekeepers against the barbarians .

Posted by: Cruzinator at April 24, 2015 08:52 PM (P7ulB)

482 How much did Wheaties pay to use Jenner on the box and can they get a refund or sue for damages?

Posted by: SpongeBobSaget at April 24, 2015 08:52 PM (zauWW)

483 If you'll recall: in 2009, doctors who profiteered by unnecessarily removing tonsils and amputating limbs were evil, and thus we needed Obamacare. But in 2015, doctors who profiteer off of mental illness by irreversibly mutilating sexual organs are heroes and Obamacare must pay for it.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 08:52 PM (Q/rld)

484 g'early evenin', 'rons

Posted by: AltonJackson at April 24, 2015 08:52 PM (KCxzN)

485 470 So these highly-selective Ivy League universities manage to select a student body that is straight out of The Aristocrats?

--

It's damn hard to get in. Were these kids crazy in HS or did Columbia mess them up?

Posted by: @votermom at April 24, 2015 08:53 PM (cbfNE)

486 478 I just had to look at the comments on the WaPo article didn't I?
Posted by: Burn the Witch at April 24, 2015 08:49 PM (xSCb6)

I take it you also look at certain links posted here as well? Curious little fucker

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:53 PM (o4Q38)

487 Buddy's son had one. Really an interesting girl. Some of the shit she ate makes you shake your head

Posted by: Misanthropic Humanitarian, from the road
****

Kimchi? (That's food, not a name of a person.)

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:53 PM (F0Cog)

488 Late 70's

" up your nose, with a rubber hose"

2015

" up my ass, with half the class'

Posted by: seamrog at April 24, 2015 08:54 PM (Lo0IM)

489 Jeebeers..., I thought people were kidding..., both her parents are psychiatrists.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 08:54 PM (F2IAQ)

490 It's damn hard to get in. Were these kids crazy in HS or did Columbia mess them up?
Posted by: @votermom at April 24, 2015 08:53 PM (cbfNE)


And then...one summer....at band camp...

Posted by: Emma Sulkowicz at April 24, 2015 08:55 PM (V+kmg)

491 2015

" up my ass, with half the class'

Posted by: seamrog
****

The other half would need a strap-on.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:55 PM (F0Cog)

492 It's unfair but I blame the women. They are supposed to be the gatekeepers against the barbarians .
Posted by: Cruzinator at April 24, 2015 08:52 PM (P7ulB)
----
If you can't control yourselves, perhaps we should take away your right to vote and hold property.

Posted by: All Hail Eris at April 24, 2015 08:55 PM (KH1sk)

493 I think ace has plopped his heiny in front of the tv so he wont miss the two hour bruce jenner tranniepalooza! I wonder if they are going to talk about cutting his dick off and making it into an artificial vagina?

Posted by: Bruce J. at April 24, 2015 08:47 PM (iQIUe)

*********

I see him shiver with anticip......................
pation!

He'd better be live blogging this.

Now we'll finally find out if B's vagina will be constructed out of his scrotum, or a section of his colon. And the first name.

Posted by: Bruce Jenner at April 24, 2015 08:55 PM (cIoI4)

494 Were these kids crazy in HS or did Columbia mess them up?

Posted by: @votermom at April 24, 2015 08:53 PM (cbfNE)




Yes. They start out crazy; that's how they get admitted. "Elite" academia just completes the process.

Posted by: Country Singer at April 24, 2015 08:55 PM (nL0sw)

495 Kimchi? (That's food, not a name of a person.)
Posted by: Tilikum Killer Assault Whale at April

That's a Korean dish. She was from Vietnam. She always wanted our fish scraps when we cleaned fish to make a soup. Ugh. I like fish fillets not guts, heads & fins

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:56 PM (o4Q38)

496 It's damn hard to get in. Were these kids crazy in HS or did Columbia mess them up?
Posted by: @votermom at April 24, 2015 08:53 PM (cbfNE)

******

As stated above, it was difficult for Columbia to weed all the sane ones, but apparently they rose to the challenge.

Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 08:56 PM (XrHO0)

497 The whole Bruce Jenner story has been so sad to witness. He is being used and exploited by an amoral media trying to push a transgender acceptance agenda. When he eventually kills himself or his life takes some other tragic turn, the same media will lay blame on the persecution that he endured by a bigoted "society" that refused to accept him --- meaning us.

Posted by: L, Elle at April 24, 2015 08:57 PM (2x3L+)

498 I think there's a larger issue that art is dead and it was raped and
murdered on college campuses. Art is supposed to uplift the human
experience. Dragging a mattress on your back is just a stunt. Painting
in menstrual blood is just gross.

It isn't dead, it's just that representational art isn't as popular. Check out Richard Schmid if you care. There are a lot of great painters out there. That mattress thing is performance art and is as close to what I consider art as a paint brush is to her short and curlies.

Posted by: johnny yuma at April 24, 2015 08:57 PM (ahBY0)

499 489 Jeebeers..., I thought people were kidding..., both her parents are psychiatrists.
Posted by: Mike Hammer, etc., etc. at April

Someone needs some serious couch time

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 08:58 PM (o4Q38)

500 This gonna be awesome! This must be what it felt like to go to a carnival in the 19th century.

Posted by: Bruce Jenner at April 24, 2015 08:58 PM (3F6F8)

501 From now on, this guy will only have sex on a piano.

Posted by: JT at April 24, 2015 08:58 PM (OUk2v)

502 That's a Korean dish. She was from Vietnam. She always wanted our fish scraps when we cleaned fish to make a soup. Ugh. I like fish fillets not guts, heads & fins

Posted by: Misanthropic Humanitarian, from the road
****

Doh! Thought they ate it too.
Fish scraps? Ugh is right.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:59 PM (F0Cog)

503 >>society" that refused to accept him --- meaning us.
-----

And frankly I don't give a damn.
I'm tired of freaks.

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:00 PM (o4Q38)

504 Bruce Jenner, especially since now the clowns are actually saner than the average SJW

Posted by: boulder terlit hobo at April 24, 2015 09:00 PM (W540W)

505 Blame the French. They taught the Vietnamese how to cuisine.

Posted by: @votermom at April 24, 2015 09:00 PM (cbfNE)

506 are we live blogging bruce jenner or what?

Posted by: mynewhandle at April 24, 2015 09:01 PM (AkOaV)

507 I'll show you some fish scraps...

Posted by: Ready For Hillary!!11!! at April 24, 2015 09:01 PM (Dwehj)

508 Posted by: Tilikum Killer Assault Whale at April 24, 2015 08:59 PM (F0Cog)

They might I don't know for sure.

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:02 PM (o4Q38)

509 Will not watch

Posted by: ThunderB at April 24, 2015 09:02 PM (zOTsN)

510 507 I'll show you some fish scraps...
Posted by: Ready For Hillary!!11!!

...and the blind man says, "good morning ladies."

Posted by: Just the punchline at April 24, 2015 09:02 PM (Q/rld)

511 Gooble gobble.

Posted by: Bertram Cabot Jr. at April 24, 2015 09:02 PM (W5DcG)

512 Columbia: Prepare for the Nifonging.

Posted by: Phinn at April 24, 2015 09:02 PM (DLUnW)

513 Watching "El Cid"


I need a giant screen to see this on.


Posted by: naturalfake at April 24, 2015 09:02 PM (KUa85)

514 That mattress thing is performance art and is as close to what I consider art as a paint brush is to her short and curlies.

Check that, hogs hair brushes are the best for oil.

Posted by: johnny yuma at April 24, 2015 09:02 PM (ahBY0)

515 All the Bruce Jenner nics and anyone who has socked Bruce Jenner should volunteer to watch the interview and report back to the rest of us. It's your duty to the blog.

I think his story is a perfect case study in how successful the media is in influencing culture and popular opinion.

Posted by: L, Elle at April 24, 2015 09:04 PM (2x3L+)

516 We are live and ready to open Bruce Jenner's vault!

Posted by: Geraldo at April 24, 2015 09:04 PM (Dwehj)

517 Posted by: L, Elle at April 24, 2015 09:04 PM (2x3L+)

I'm watching it.

He/she doesn't want to let us down, which is why he/she took so long to transition, btw.

Now they're playing highlights from his olympics career

Posted by: mynewhandle at April 24, 2015 09:05 PM (AkOaV)

518 all hail eris: i've been on the "restrict the vote against stupid men too" bandwagon for some time :^)

I am currently vaccilating between outright monarchism, and Heinlein's notion that only veterans should vote. In the former, AtC gets the vote; and in the latter, you do. *srednop*

Posted by: boulder terlit hobo at April 24, 2015 09:05 PM (W540W)

519 433 430 How many crazy college whores does it take to screw in a light bulb?

Two . One to screw it in and one to apply the lube.

Posted by: Cruzinator at April 24, 2015 08:34 PM (P7ulB)



No, three: one to extract the light bulb from the other one's ass.
Posted by: Jay Guevara at April 24, 2015 08:34 PM (oKE6c)

I know how to get that out.

Posted by: Dr. Jan I Tor at April 24, 2015 09:05 PM (z/Ubi)

520 Excerpt from letter to Columbia (full text , http://tinyurl.com/m8ts2na ) authored by Dr. Leong (mother) and Dr. Sulkowicz (father) of the coed:

"As other avenues have failed, we wish that the president and the board would act as a higher court of appeals, and allow Emma a properly conducted retrial in which she has the right to an advocate, unfettered by conflict of interest, who will prosecute her case on her behalf; the right to present the best case possible; the right to present her motivations truthfully; the right to cross-examine; the right to answer unfounded allegations about her character; and the ability to demonstrate a pattern of behavior on the part of the accused party."

Well, they are going to get their wish, it seems.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:05 PM (F2IAQ)

521 Oh God, my mother is awesome for laughs. She just called me:



Mom: "Who is this Bruce Jennings guy they gonna have on TV? Don't he sing country music?"


Me: "You're thinking of Waylon Jennings, Mom. This is Bruce Jenner, the guy that won some gold medals in the Olympics back back in the 70s."


Mom: "He looks like a woman! What's he doing on TV?"


Posted by: Country Singer at April 24, 2015 09:05 PM (nL0sw)

522

Now they're playing highlights from his olympics career
Posted by: mynewhandle at April 24, 2015 09:05 PM (AkOaV)

Glad he was never on the Kaboom boxes

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:06 PM (o4Q38)

523 Mom: "He looks like a woman! What's he doing on TV?"

Posted by: Country
-----------------

* makes a note to send Country's mother some flowers on Mother's Day *

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:07 PM (F2IAQ)

524 "what im doing is going to do some good, and we're going to change the world, diane"

Posted by: mynewhandle at April 24, 2015 09:08 PM (AkOaV)

525 The endless parade of human debris...

Posted by: Geraldo at April 24, 2015 09:08 PM (Dwehj)

526 >>> Posted by: Country Singer at April 24, 2015 09:05 PM (nL0sw)

Lol! That sounds like the very awkward conversation I had with my parents when I had to explain homosexuality to them.

Posted by: L, Elle at April 24, 2015 09:08 PM (2x3L+)

527 Country Singer, your mom is awesome.

Posted by: johnny yuma at April 24, 2015 09:08 PM (ahBY0)

528 now a segment on how horrible trans* people have it. ridicule, hate... treating someone as a joke

Posted by: mynewhandle at April 24, 2015 09:09 PM (AkOaV)

529 South Park would get more death threats today for making "Mr. Garrison's Fancy New Vagina," than they would for an episode involving Mohammed.

Posted by: Buzzion at April 24, 2015 09:09 PM (z/Ubi)

530 "The endless parade of human debris..."

Hell has emptied, and all the devils are here.

Posted by: boulder terlit hobo at April 24, 2015 09:09 PM (W540W)

531 Well, they are going to get their wish, it seems.
Posted by: Mike Hammer, etc., etc. at April 24, 2015 09

Be careful for what you wish for. In the meantime I will get the popcorn

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:09 PM (o4Q38)

532 Glad he was never on the Kaboom boxes
Posted by: Misanthropic
-------------------

A clown, in both cases.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:09 PM (F2IAQ)

533 On Twitter from instapundit Jenner is a republican and hates obama

Posted by: ThunderB at April 24, 2015 09:09 PM (zOTsN)

534 Greetings:

Lugging around a mattress on today's rape-culture campuses would, to me at least, seem to be a bit of a lure to the next available member of the multitude of rapists all over those places.

Posted by: 11B40 at April 24, 2015 09:09 PM (abx5/)

535 Mom: "He looks like a woman! What's he doing on TV?"


Posted by: Country Singer

I resemble that remark.

Posted by: Paul McCartney at April 24, 2015 09:10 PM (Q/rld)

536
528 now a segment on how horrible trans* people have it. ridicule, hate... treating someone as a joke
Posted by: mynewhandle at April 24, 2015 09

Aren't they?

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:10 PM (o4Q38)

537 Hell has emptied, and all the devils are here.
Posted by: boulder
--------------

I think this was predicted somewhere..., let me think....

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:11 PM (F2IAQ)

538 Posted by: L, Elle at April 24, 2015 09:08 PM (2x3L+)



Heh! My Dad used to refer to gays as "No-No's." One of his nurses right before he passed was a gay guy (and Mom still raves about how good of a nurse the guy was). One night Dad called my Mom over close to the bed and whispered, "He sure is nice, but I think he's a No-No."

Posted by: Country Singer at April 24, 2015 09:11 PM (nL0sw)

539 I tried to watch Brucilla but i couldn't take it. It's all about him being a victim and hoping to change the world.

Posted by: Cruzinator at April 24, 2015 09:11 PM (P7ulB)

540 These depositions are gonna be great!

Posted by: Flounder, The Amish Ambulance Chaser at April 24, 2015 09:11 PM (uDiVt)

541 The only reason bj hates obomy is that he was turned down. Obomy is only fucked by black guys.

Posted by: Ima Trolle at April 24, 2015 09:12 PM (W275d)

542 Lugging around a mattress on today's rape-culture campuses would, to me at least, seem to be a bit of a lure to the next available member of the multitude of rapists all over those places.
Posted by: 11B40
----------------------

Heh. How about a Slutwalk?

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:12 PM (F2IAQ)

543 If Jenner hates Obama then he's the first chick in his crazy ass extended family to hate a black man.

Posted by: NCKate at April 24, 2015 09:13 PM (TDMVi)

544 And apparently the hardcore SJW lesbians HATE the transgendered men/women etc...

These people are confusing.

Posted by: Ktgreat at April 24, 2015 09:13 PM (Bl4dy)

545 These depositions are gonna be great!
Posted by: Flounder
---------

Gonna be great reading if they are submitted into evidence.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:13 PM (F2IAQ)

546 Is Jenner's surgery de-dictable on this years tax form ?

Or is that just nuts ?

Posted by: seamrog at April 24, 2015 09:14 PM (Lo0IM)

547 We are live and ready to open Bruce Jenner's vault!


Posted by: Geraldo
****

Oh God, nooooooo!

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:14 PM (F0Cog)

548 NCKate!!! Too funny!

Posted by: ThunderB at April 24, 2015 09:14 PM (zOTsN)

549 >>>On Twitter from instapundit Jenner is a republican and hates obama

Posted by: ThunderB at April 24, 2015 09:09 PM (zOTsN)<<<


Bruce is still more manly than most of our caucus.

Posted by: Speaker John Boneless at April 24, 2015 09:14 PM (1FyZ2)

550
543 If Jenner hates Obama then he's the first chick in his crazy ass extended family to hate a black man.
Posted by: NCKate at April 24, 2015 09:13 PM (TDMVi

Should I denounce myself? I snickered out loud at that Kate

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:14 PM (o4Q38)

551 "we're going to change the world, diane"

Yeah, that's what we thought when we joined the carnival. Keep dreamin', pal.

Posted by: The Bearded Lady and the Three Legged Man at April 24, 2015 09:15 PM (Dwehj)

552 1. Yes, I would hit that.

2. But first I would double-bag the little joncelli.

3. Remember the Hot/Crazy Matrix, and keep it holy: https://www.youtube.com/watch?v=hKWmFWRVLlU

Posted by: joncelli at April 24, 2015 09:15 PM (ENczY)

553 Is Jenner's surgery de-dictable on this years tax form ?

Or is that just nuts ?
Posted by: seamrog
----------------------

ISWYDT

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:15 PM (F2IAQ)

554 >>> "The endless parade of human debris..."

Hell has emptied, and all the devils are here.
Posted by: boulder terlit hobo at April 24, 2015 09:09 PM (W540W)

Bears repeating bc of the succinctness of this comment.

Posted by: L, Elle at April 24, 2015 09:15 PM (2x3L+)

555 I'll keep watching Forbidden Planet instead of the train wreck.

Posted by: Anna Puma (+SmuD) at April 24, 2015 09:16 PM (lQHc1)

556 You mean I'm not really a woman!? I'm just a man with a mutilated penis!?

Posted by: Mr. Garrison at April 24, 2015 09:16 PM (z/Ubi)

557 Remember on Dad's Army, when Mrs Pike would do or say something overbearing towards her son, Mainwaring would tell Wilson "If she doesn't stop coddling him, she'll turn him into a nancy-boy." Good times, good times.

Posted by: Prince Ludwig the Indestructible at April 24, 2015 09:16 PM (Q/rld)

558 Keep dreamin', pal.
Posted by: The Bearded Lady and the Three Legged Man
-------------------

You left out the triple breasted woman.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:16 PM (F2IAQ)

559 When guilt and rejection overcomes pleasure...revenge is the only virtue.
Emma the 'mattress muffin' Sulkowicz!

Posted by: tbd at April 24, 2015 09:16 PM (eHRTo)

560 I won't watch this Jenner character. Playoff Hockey is on. I am going to scratch my junk and watch Playoff Hockey

Posted by: Truck Monkey is a Mime..... Serious at April 24, 2015 09:16 PM (fLKzW)

561 Did he suck olympic dick, or did that cum later?

Posted by: Ima Trolle at April 24, 2015 09:17 PM (W275d)

562 ... yeah, the tempest has some good lines.

o brave new world that has such people in it

Posted by: boulder terlit hobo at April 24, 2015 09:17 PM (W540W)

563 Does Jenner have sex with anything? What's the f'n point? If heshe can't be happy the way it is what the hell is surgery gonna do? It's crazy.
Is he still with those damn Kardasians? The whole lot of them are sorry excuses for human beans.

Posted by: freaked at April 24, 2015 09:17 PM (JdEZJ)

564 Is Jenner talking about the old lady he killed with his car?

Posted by: NCKate at April 24, 2015 09:19 PM (TDMVi)

565 The photos of her carting that mattress around make her look like a nut or a hooker or a nutty hooker.

Posted by: Bruce J. at April 24, 2015 06:20 PM (iQIUe)


Indeed. She sounds crazier than a shithouse rat.

Posted by: Alberta Oil Peon at April 24, 2015 09:19 PM (wfUWX)

566 490
It's damn hard to get in. Were these kids crazy in HS or did Columbia mess them up?

Posted by: @votermom at April 24, 2015 08:53 PM (cbfNE)

****************
Fairly wealthy with a near-absentee dad busy getting wealthier. Mom's a professional, too. Not pronouncing judgment, but:

Our local public high school is the best large high school in the state. Incredible test scores and college acceptance rates.

It's also one of the richest, and there have been three suicide attempts ON CAMPUS this year alone. To say nothing of the drugs.


Posted by: Bob's House of Flannel Shirts and Wallet Chains at April 24, 2015 09:19 PM (yxw0r)

567 Bears repeating bc of the succinctness of this comment.
Posted by: L, Elle
--------------------

The century of constant sacrifice by the normal to the abnormal - G.K. Chesterton

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:19 PM (F2IAQ)

568 He sure seemed to love pussy, so is he a lesbian now?

Posted by: Ima Trolle at April 24, 2015 09:19 PM (W275d)

569 Mad Max trailers on the tube all the time now. I think I could piece them together to watch the entire movie.

All joking aside, seems like it could be a fun guilty pleasure movie .

Posted by: Cruzinator at April 24, 2015 09:19 PM (P7ulB)

570 Jenner talks about sneaking out of the house at age 8 in a dress. claims he never heard of transsexuals.

also says hes straight & attracted to women. says sexuality is different than gender issues.

Posted by: mynewhandle at April 24, 2015 09:19 PM (AkOaV)

571 The Harpy Hooker

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:20 PM (F2IAQ)

572 So this is going on: https://twitter.com/rvabelieves

Singing "the pledge" - the Virginia. attorney General. Henrico and other commonwealth attorneys... Campus police, public and private, every tier: UR, VCU JTCC and on and on....

Willing suspension of disbelief is for theatre, not serious crminal investigations. Neutral investigation and evidence gathering ....isn't that was law enforcement is about?

Posted by: Sarahw at April 24, 2015 09:21 PM (lv2k0)

573 >>> Does Jenner have sex with anything?

I think most trans people wind up prostituting themselves once they find out that guys aren't lining up to do a "woman" that used to be a man. He is so famous now that he will find himself isolated and even more miserable than he was as a man.

Posted by: L, Elle at April 24, 2015 09:21 PM (2x3L+)

574 Hey, Mike. Ready for the monsoon this weekend?

Posted by: NCKate at April 24, 2015 09:21 PM (TDMVi)

575 570 also says hes straight & attracted to women. says sexuality is different than gender issues.
Posted by: mynewhandle at April 24, 2015 09:19 PM


Might be true. Why should I give a crap? This is his private business.

Posted by: Splunge at April 24, 2015 09:22 PM (qyomX)

576 560 I won't watch this Jenner character. Playoff Hockey is on. I am going to scratch my junk and watch Playoff Hockey
Posted by: Truck Monkey is a Mime..... Serious at April 24, 2015 09:16 PM (fLKzW)


For Bruce Jenner, "scratch my junk" has a whole different meaning.

Posted by: rickl at April 24, 2015 09:22 PM (sdi6R)

577 sneaking out of the house at age 8 in a dress

But I'll bet he could at least throw a baseball...

Posted by: Prez'nit O'Dhimmi at April 24, 2015 09:22 PM (Dwehj)

578 564 Is Jenner talking about the old lady he killed with his car?


No shit. What the hell happened with that? The crazy MF should be locked up and here he is on TV in drag gonna change the world.

I'm watching Forbidden Planet too. One of my favorite movies. I like cheese.

Posted by: freaked at April 24, 2015 09:22 PM (JdEZJ)

579 now soviet vs us soviet shit, bruce as hero

Posted by: mynewhandle at April 24, 2015 09:22 PM (AkOaV)

580 Willing suspension of disbelief is for theatre, not serious crminal investigations. Neutral investigation and evidence gathering ....isn't that was law enforcement is about?
Posted by: Sarahw

Naw bro.

Posted by: Wisconsin Prosecutors at April 24, 2015 09:22 PM (Q/rld)

581 So he is a lesbian?

Posted by: ThunderB at April 24, 2015 09:23 PM (zOTsN)

582 571 The Harpy Hooker
Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:20 PM (F2IAQ)

How is Marie Harf involved in this?

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:23 PM (o4Q38)

583 For Bruce Jenner, "scratch my junk" has a whole different meaning.

As in scratch off.

Posted by: Prez'nit O'Dhimmi at April 24, 2015 09:23 PM (Dwehj)

584 Most trannies end as amateur or professional butt sluts.

Posted by: Ima Trolle at April 24, 2015 09:24 PM (W275d)

585 Reading this complaint... oof. I went to undergrad up the road a while back. Met and knew of several girls like that. Apparently, "don't stick your dick in crazy" doesn't translate to German. Thank God accusing random guys you know of rape wasn't a *thing* when I was in college.

BTW, dibs on "Sophmore Sexual Encounter" as my fantasy team's name next year.

Posted by: LawLurker at April 24, 2015 09:24 PM (zKwtX)

586 Posted by: Splunge at April 24, 2015 09:22 PM (qyomX)

His private business? He's giving a world wide interview as you typed that.

Posted by: Cruzinator at April 24, 2015 09:24 PM (P7ulB)

587
No such thing as transgender.

You get born male or female and will die as one or the other.

Matters not what gets sliced off or sown on in the interim.

Posted by: irongrampa at April 24, 2015 09:24 PM (jeCnD)

588 *up the road from Columbia

Posted by: LawLurker at April 24, 2015 09:24 PM (zKwtX)

589 I am currently vaccilating between outright monarchism, and Heinlein's notion that only veterans should vote. In the former, AtC gets the vote; and in the latter, you do. *srednop*
Posted by: boulder terlit hobo at April 24, 2015 09:05 PM (W540W)
----
Normally I'm all for greasing the guillotines with blue blood, but would make an exception for AtC. She would be a working empress.

Posted by: All Hail Eris at April 24, 2015 09:24 PM (KH1sk)

590 576 560 I won't watch this Jenner character. Playoff Hockey is on. I am going to scratch my junk and watch Playoff Hockey
Posted by: Truck Monkey is a Mime..... Serious at April 24, 2015 09:16 PM (fLKzW)

For Bruce Jenner, "scratch my junk" has a whole different meaning.
Posted by: rickl at April 24, 2015 09:22 PM (sdi6R)

I'm in Phoenix busting my mother in law. ONT is going to be too damn early. And I have to wear pants Damn

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:25 PM (o4Q38)

591 *up the road from Columbia

--

My gps is broken. NYU?

Posted by: @votermom at April 24, 2015 09:26 PM (cbfNE)

592 Hey, Mike. Ready for the monsoon this weekend?
Posted by: NCKate
--------------------------

Wait..., have you been listening to the forecasters again?

We'll see. Sure seems to be some weather headed this way. I always try to steer it a little north/south, but this time looks like we may take it on the nose. We are fortunate here in that the mountains generally break things up a bit.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:26 PM (F2IAQ)

593 No such thing as transgender.

You get born male or female and will die as one or the other.

Matters not what gets sliced off or sown on in the interim.
Posted by: irongrampa

This. And waking up to this undeniable, objective reality is the reason so many post-op trannies commit suicide. They're not a woman, they're a mutilated and emasculated man. (Or vice-versa)

Posted by: Prince Ludwig the Indestructible at April 24, 2015 09:26 PM (Q/rld)

594 586 His private business? He's giving a world wide interview as you typed that.
Posted by: Cruzinator at April 24, 2015 09:24 PM (P7ulB)


Yes, I know. My point was that he should shut the hell up and live his life. That's his business. If I want to consider him to be a sick weirdo, that's my business. I'd still be polite to him, were we to meet.

Posted by: Splunge at April 24, 2015 09:26 PM (qyomX)

595 587
No such thing as transgender.

You get born male or female and will die as one or the other.

Matters not what gets sliced off or sown on in the interim.
Posted by: irongrampa at April 24, 2015

As I've said before

You born with a dick: you're a guy
You born with a pussy: you're a chick

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:26 PM (o4Q38)

596 votermom -

The other way. Fordham.

Posted by: LawLurker at April 24, 2015 09:27 PM (zKwtX)

597 Bruised Jender

Posted by: seamrog at April 24, 2015 09:27 PM (Lo0IM)

598 Bruce, you are either a tranny fag or a tranny dyke. Pick one.

Posted by: Ima Trolle at April 24, 2015 09:27 PM (W275d)

599 also says hes straight attracted to women. says sexuality is different than gender issues.

Maybe all of this media coverage is oh, I don't know, about money? Fcuker is so broke he had to cut his dick off.

Posted by: johnny yuma at April 24, 2015 09:27 PM (ahBY0)

600 Ohhh. I heard it's a nice school.

Posted by: @votermom at April 24, 2015 09:27 PM (cbfNE)

601 Matters not what gets sliced off or sown on in the interim.


It's the grass is always greener on the the other side syndrome. People are stupid like that. Add some crazy in with it and anything's possible. Some folks are just never happy.

Posted by: freaked at April 24, 2015 09:28 PM (JdEZJ)

602 You born with a dick: you're a guy
You born with a pussy: you're a chick

Posted by: Misanthropic Humanitarian, from the road
****
What if you are born with both?
Asking for a friend. Well not friend, dolphin.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:28 PM (F0Cog)

603 I'm in Phoenix busting my mother in law. ONT is going to be too damn early. And I have to wear pants Damn

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:25 PM (o4Q3




Your wife ok with that?

Posted by: Country Singer at April 24, 2015 09:29 PM (nL0sw)

604 Maybe being married to Kris K makes a dude want to self-bobbit.

Posted by: @votermom at April 24, 2015 09:29 PM (cbfNE)

605 Normally I'm all for greasing the guillotines with blue blood, but would make an exception for AtC. She would be a working empress.
Posted by: All Hail Eris
--------------

Heh.
Madame Defarge

"J'accuse!"

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:29 PM (F2IAQ)

606 votermom -

It was OK. Too damn expensive. 28 year old me wants to slap 18 year old me for not going to state school.

Posted by: LawLurker at April 24, 2015 09:29 PM (zKwtX)

607 595 You born with a dick: you're a guy
You born with a pussy: you're a chick


I think that's true, which is not to say that some are not horribly unhappy with what the cards have dealt. But I'd need really good proof that such people's happiness lies in surgery and simulation and role-playing.

Posted by: Splunge at April 24, 2015 09:29 PM (qyomX)

608
Whee did he get the dress when he was 8? Does he have a sister? And where wd he go?

Without a dick, how is he going to have sex with a woman?

Posted by: Bruce J. at April 24, 2015 09:29 PM (iQIUe)

609 Monsters from the Id...

Nice outfit on Anne Francis

Posted by: Ian Galt at April 24, 2015 09:29 PM (dmepw)

610
And if he is going to be a woman, how is a woman going to have sex with him? Did he say he was not a lesbian?

Posted by: Bruce J. at April 24, 2015 09:30 PM (iQIUe)

611 587 No such thing as transgender.

You get born male or female and will die as one or the other.

Matters not what gets sliced off or sown on in the interim.
Posted by: irongrampa at April 24, 2015 09:24 PM (jeCnD)

It's a cult. They prey on people with low self-esteem, convince them that their problems aren't their fault (the easiest thing in the world o convince anybody of), then supply an explanation to back it up: Reality itself is wrong, you're an X soul in a Y body. Everything would magically be better if you were born with the other fiddly bits. Then they supply a solution: Make the reality match the fantasy with hormones and surgery. Reality often disappoints, and suicide rates among post-op transsexuals are high, but we're not allowed to say that.

If I was to go around calling myself the Emperor of Mars (I will pretend for the sake of this argument that I have never done that as an argument tactic), I'd be bundled up in a straightjacket and hauled off to the loony bin. But if a man with all of the various marriage tackle that entails calls himself a woman, that's somehow sacred.

There is no spiritual component of gender. Gender isn't even a thing, it's just the words we use to describe a thing. The thing is biological sexes, and there are only two of them.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:30 PM (3HxZe)

612
Monsters from the Id...

Nice outfit on Anne Francis


I'd hit it.

Posted by: eleven at April 24, 2015 09:30 PM (MDgS8)

613 Too much...35 years ago, I bedded a nice girl who'd been coming on to me for weeks. I wasn't that attracted to her, but proximity and circumstances found us in the sack. The next day...she was shocked....shocked, I tell you, that she had allowed herself to be used by a brute like me. I'll call figurative buyer's remorse on this one...she cried long and loud to her friends that she'd fallen for someone beneath her station because they knew and chuckled about it. I'm so glad that was 1980 and not 2015. I'm thinking all of us here have made bad choices, but we don't carry mattresses on our backs to self-flagellate. Sad.

Posted by: rduke at April 24, 2015 09:30 PM (6uR4A)

614 Scissor me bitch!

Posted by: Ima Trolle at April 24, 2015 09:30 PM (W275d)

615 Fcuker is so broke he had to cut his dick off.
Posted by: johnny yuma
------------------

* reconsiders contemplated frivolous purchase *

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:30 PM (F2IAQ)

616 608 Without a dick, how is he going to have sex with a woman?

Good point. Scissoring? The obvious? Behold, the "lesbian trapped in a man's body" joke made flesh.

Posted by: Splunge at April 24, 2015 09:31 PM (qyomX)

617 Ahh, what a fine old thread this is.

I love the smell of Valu-rite and cheap stogies.

*sniff*

hmm, still 4-20 in here?

Posted by: JohnnyBoy at April 24, 2015 09:31 PM (KG0mU)

618 Your wife ok with that?

Posted by: Country Singer
****

Bad mama gotta be taken down.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:31 PM (F0Cog)

619 The 'Wheaties' cover can only take you so far in life...

Posted by: tbd at April 24, 2015 09:31 PM (eHRTo)

620 Wait...he wants to have his penis gutted and inverted up into his abdomen so he can use a strap-on? Lord, come back soon.

Posted by: Bob's House of Flannel Shirts and Wallet Chains at April 24, 2015 09:31 PM (yxw0r)

621 Surely the Krell missed something....and don't call me Shirley

Posted by: Ian Galt at April 24, 2015 09:32 PM (dmepw)

622 votermom -

You an NYU alum?

Posted by: LawLurker at April 24, 2015 09:32 PM (zKwtX)

623
I for one welcome the Rhubarb Yoko ONT.

Save us Maet you handsome devil you.

Posted by: eleven at April 24, 2015 09:32 PM (MDgS8)

624 Wait. He is cutting his junk off so he has to use a dildo with a woman. And that is pleasing to him?

Posted by: ThunderB at April 24, 2015 09:32 PM (zOTsN)

625
There is a videocompairing the "mattress girl" and one time porn star "Cytheria" who was the victim of a home invasion and rape, onyoutube. You can see from the body language differences between the two, that they had very different encounters.

Posted by: Darth Randall at April 24, 2015 09:33 PM (KlVdw)

626 I mean seriously maybe Kris K keeps demanding rear entry and he's sick of it so he's all like "Enough already! I'm a woman!"

*nods sagely*

Posted by: @votermom at April 24, 2015 09:33 PM (cbfNE)

627 Lord, come back soon.
Posted by: Bob's House of Flannel Shirts and Wallet Chains

Considering the state of things, would he really want to?

Posted by: Prince Ludwig the Indestructible at April 24, 2015 09:33 PM (Q/rld)

628
Man, I really miss dog shaming.

Posted by: JohnnyBoy at April 24, 2015 09:33 PM (KG0mU)

629 this story has me just about fucking speechless

Posted by: Beth at April 24, 2015 09:33 PM (Epq7Y)

630
Surely the Krell missed something....and don't call me Shirley

Wait....you just crossed the meme streams.

We're all gonna die.

I like it.

Posted by: eleven at April 24, 2015 09:33 PM (MDgS8)

631 Your wife ok with that?
Posted by: Country Singer at April 24, 2015 09

Oops how do I get busting and not visiting?
Hockey

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:34 PM (o4Q38)

632 Who's more unsettling -- transitioning Bruce Jenner or the Trivago guy?

Posted by: All Hail Eris at April 24, 2015 09:34 PM (KH1sk)

633 622 hahaha no.
Immigrant from school no one's heard of

Posted by: @votermom at April 24, 2015 09:34 PM (cbfNE)

634 Ebay Listing

Bruce Jenner's Penis
Shipping: $149.99 Expedited Refrigerated Shipping Required

Current Bid: $1,750
High Bidder: obamapres2012

Returns: Seller does not offer returns

Posted by: EBay at April 24, 2015 09:34 PM (qyomX)

635 Eddie Murphy did a song called Boogie In Your Butt.
That was considered outrageous back then.
Now.....

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:34 PM (F0Cog)

636 How's Chaz Bono been? Last I heard she was saving her money up for penis surgery.

Posted by: NCKate at April 24, 2015 09:34 PM (TDMVi)

637 632
Who's more unsettling -- transitioning Bruce Jenner or the Trivago guy?



Posted by: All Hail Eris at April 24, 2015 09:34 PM (KH1sk)

Trivago guy. Easily.

Posted by: Bob's House of Flannel Shirts and Wallet Chains at April 24, 2015 09:35 PM (yxw0r)

638 I'd like to know what her "project" grade is now that it has brought on a federal lawsuit and her prof is a plaintiff. I hope the prof notes and her "written proposal", notes, multi-media, etc is part of discovery. It should be funny as hell.

Posted by: Lester at April 24, 2015 09:35 PM (2UPXV)

639 Also, I may have to steal that.

Posted by: Bob's House of Flannel Shirts and Wallet Chains at April 24, 2015 09:35 PM (yxw0r)

640 Does he understand that if he cuts off his dick, having an orgasm is going to be really difficult?

Posted by: Bruce J. at April 24, 2015 09:35 PM (iQIUe)

641 I suspect after the surgery he will discover he likes the peen. Of other men

Posted by: ThunderB at April 24, 2015 09:35 PM (zOTsN)

642 Wait, wait, wait. I'm not watching that sideshow, so let me get this straight. Bruce Jenner is gonna cut his dick off, so he can be a lesbian?

I just found the Kardashian thing mildly annoying before. Now, I'm starting to wish SMOD would dispatch a small offering, just large enough to obliterate their estate.

Posted by: LawLurker at April 24, 2015 09:36 PM (zKwtX)

643 Who's more unsettling -- transitioning Bruce Jenner or the Trivago guy?



Posted by: All Hail Eris
****

Neither. That Alan Alda was considered a sex symbol

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:36 PM (F0Cog)

644 640 the true experience of womanhood - faking it

Posted by: @votermom at April 24, 2015 09:36 PM (cbfNE)

645 One can only hope for a 7 figure settlement, prison term for mattress chick and multiple firings at Columbia including the Dean and anyone else who enabled this injustice.

Posted by: The Walking Dude at April 24, 2015 09:37 PM (cCxiu)

646 613 ..... I'm thinking all of us here have made bad choices, but we don't carry mattresses on our backs to self-flagellate. Sad.
Posted by: rduke at April 24, 2015 09:30

Six pack and a pint. Everything cleared up

Posted by: Misanthropic Humanitarian, from the road at April 24, 2015 09:37 PM (o4Q38)

647 613 I'm thinking all of us here have made bad choices, but we don't carry mattresses on our backs to self-flagellate.

Drama. The more a chick has it, the more you should stay away.

Posted by: Splunge at April 24, 2015 09:38 PM (qyomX)

648 Six pack and a pint. Everything cleared up

Posted by: Misanthropic Humanitarian, from the road
****
Piker.
Try a shovel and a shallow hole in the middle of the desert.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:38 PM (F0Cog)

649 genitals dont equal gender says a woman in a white lab coat

Posted by: mynewhandle at April 24, 2015 09:38 PM (AkOaV)

650 Kinda off topic, but where does one put the mattress when, say you go in a classroom or a campus coffee shop?

Does she park it outside?



Also, I love that it was her Art class thesis. I mean, can you imagine the Professor faced with saying no to this asshole?

Posted by: Ktgreat at April 24, 2015 07:14 PM (Bl4dy)


Kinda funny that mattress never caught fire. With all the grease and oil and fluids in it, spontaneous combustion has to be a real hazard.

Posted by: Alberta Oil Peon at April 24, 2015 09:39 PM (wfUWX)

651 "Does he understand that if he cuts off his dick, having an orgasm is going to be really difficult?"


I don't think they chop it off. I think they turn it inside out and shove it up inside to make a vayjay.


Somehow.

Posted by: Ricardo Kill at April 24, 2015 09:39 PM (4MMvf)

652 Crazy women are great in bed. Beyond that, not so much.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:39 PM (F0Cog)

653 Damn, my grassroots payback for the Holocaust really went viral, didn't it?

Posted by: Emma Sulkowicz at April 24, 2015 09:40 PM (qyomX)

654 this is sick...

same argument as gay marriage, by the way... born that way, totally normal, etc. etc.

Posted by: mynewhandle at April 24, 2015 09:41 PM (AkOaV)

655 Will he keep his prostate? Guess anal orgasms will be it for him from now on.

Posted by: NCKate at April 24, 2015 09:41 PM (TDMVi)

656
Know what would be nice?

If the gay sector would celebrate their homosexuality the way I celebrate my heterosexuality--quietly, with no fanfare,
and get the FUCK out of my face with it.

Posted by: irongrampa at April 24, 2015 09:41 PM (jeCnD)

657 and heres a hate quote from Deuteronomy

Posted by: mynewhandle at April 24, 2015 09:41 PM (AkOaV)

658 Falling Skies is returning for another season. Surprised it's not talked about more at aos.

Posted by: Cruzinator at April 24, 2015 09:42 PM (P7ulB)

659 652 Crazy women are great in bed. Beyond that, not so much.
Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:39 PM


That was the old rule, yes. But if someone told them that they can exercise their crazy afterwards by crying rape and getting rewarded, even that is ruined now.

Posted by: Splunge at April 24, 2015 09:42 PM (qyomX)

660 652 Crazy women are great in bed. Beyond that, not so much.
Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:39 PM (F0Cog)
---------------
Nothing but total truth in that statement!!!

Posted by: tbd at April 24, 2015 09:42 PM (eHRTo)

661 652
Crazy women are great in bed. Beyond that, not so much.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:39 PM (F0Cog)


I'm not proud of everything I did in my 20s, but this is troothiness.

Posted by: Bob's House of Flannel Shirts and Wallet Chains at April 24, 2015 09:43 PM (yxw0r)

662 I keep wondering when someone is going to put the words "delusion" and "transgender" in the same sentence.

If being a man, and thinking you're a woman is not a delusion, then I think it's time to just put the DSM into the shredder.

Posted by: LawLurker at April 24, 2015 09:43 PM (zKwtX)

663 I gave up on Falling Skies in season 5

Posted by: @votermom at April 24, 2015 09:43 PM (cbfNE)

664 That was the old rule, yes. But if someone told them that they can exercise their crazy afterwards by crying rape and getting rewarded, even that is ruined now.

Posted by: Splunge
****

Hence the shovel and shallow hole in the desert..../
(some dark humor there)

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:43 PM (F0Cog)

665 649 genitals dont equal gender says a woman in a white lab coat
Posted by: mynewhandle at April 24, 2015 09:38 PM (AkOaV)

Gender isn't even a thing except in linguistics. Let's stop giving this any credibility. There are two biological sexes. Genders are the linguistic devices we use to describe those biological sexes. There is no spiritual component to this, no "soul born in the wrong body" crap, and there is nothing empirical or falsifiable about such a belief.

It's religious, and more specifically, it's a cult. As such, any attempt to legislate things based on gender, such as "other" restrooms in public buildings is a violation of the Separation of Church & State, as well as the establishment cause.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:44 PM (3HxZe)

666 Every tv show will have to have a trans character now. Since gay is passe.

Posted by: NCKate at April 24, 2015 09:44 PM (TDMVi)

667 establishment cause.
Posted by: Cato the Rebel Without a Party at April 24, 2015 09:44 PM (3HxZe)

clause. stupid stuck key.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:46 PM (3HxZe)

668 624 Wait. He is cutting his junk off so he has to use a dildo with a woman. And that is pleasing to him?
Posted by: ThunderB at April 24, 2015 09:32 PM (zOTsN)

The more depraved Roman emperors had nothing on 2015 AD.

Posted by: Donna &&&&&& V. (brandishing ampersands) at April 24, 2015 09:46 PM (+XMAD)

669 Posted by: @votermom at April 24, 2015 09:43 PM (cbfNE)

It got interesting again . At least for me. I just want to see an ending.

Posted by: Cruzinator at April 24, 2015 09:46 PM (P7ulB)

670 If the gay sector would celebrate their homosexuality the way I celebrate my heterosexuality--quietly, with no fanfare, and get the FUCK out of my face with it.
Posted by: irongrampa
--------------------

Why..., it's almost as if there is something wrong with them...

Posted by: Mike Hammer, etc., etc. at April 24, 2015 09:46 PM (F2IAQ)

671 The new eunuchs

Posted by: ThunderB at April 24, 2015 09:46 PM (zOTsN)

672
If it is her art thesis, shdnt she be carrying it in a portfolio or something?

Posted by: Bruce J. at April 24, 2015 09:47 PM (iQIUe)

673 I suspect after the surgery he will discover he likes the peen. Of other men

I suspect he like bookoo sucky sucky many year.

Posted by: johnny yuma at April 24, 2015 09:47 PM (ahBY0)

674 Gender is fluid but your race determines your destiny.

- Party of "science"

Posted by: @votermom at April 24, 2015 09:47 PM (cbfNE)

675 666 Every tv show will have to have a trans character now. Since gay is passe.
Posted by: NCKate at April 24, 2015 09:44 PM (TDMVi)

Eventually they'll mine out everything transgressive, and by then, normal will have been so vilified that they'll have to go back to it as the new cool by default.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:47 PM (3HxZe)

676
Every tv show will have to have a trans character now. Since gay is passe.

Actually....doesn't they gay mafia have a problem with the TGs?

Like..."They're not one of us?"

Posted by: eleven at April 24, 2015 09:47 PM (MDgS8)

677 Might be true. Why should I give a crap? This is his private business.
Posted by: Splunge at April 24, 2015 09:22 PM (qyomX)


It used to be, & then he fucking broadcast it everywhere & went n TeeVee & homoed about it ad nauseum. I think at some point you treat screwed up, flamingly overt narcissists the same way Ol' Yeller got treated.

Posted by: Snoodling World Champ 1997 at April 24, 2015 09:48 PM (Q819Q)

678 I have seen a few T-girls who WISH they had not had their tallywhacker turned inside out.
Howard Stern show etc.

Posted by: Tilikum Killer Assault Whale at April 24, 2015 09:49 PM (F0Cog)

679 675 Eventually they'll mine out everything transgressive, and by then, normal will have been so vilified that they'll have to go back to it as the new cool by default.
Posted by: Cato the Rebel Without a Party at April 24, 2015 09:47 PM (3HxZe)


They do that, yes. Witness hipsters wearing the glasses my Dad wore in the early 1960's. But in this case, I don't think we need go that far. I don't think there will be a big market for TV shows with obligatory tranny characters.

Posted by: Splunge at April 24, 2015 09:49 PM (qyomX)

680 674 Gender is fluid but your race determines your destiny.

- Party of "science"
Posted by: @votermom at April 24, 2015 09:47 PM (cbfNE)

Millions of genders. 4 races. Not even an "other" box on most forms.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:49 PM (3HxZe)

681 How many college graduations will Jenner be speaking at next month?

Posted by: NCKate at April 24, 2015 09:49 PM (TDMVi)

682 When will he carry a mattress around

Posted by: ThunderB at April 24, 2015 09:50 PM (zOTsN)

683 >>> I love how they refer to him as a serial rapist.

No, we said he is a cereal rapist.

Posted by: Snap, Crackle & Pop at April 24, 2015 09:50 PM (Ua6T/)

684 I find that curious

Posted by: ThunderB at April 24, 2015 07:52 PM (zOTsN)


Sounds more like "hindplay" to me.

Posted by: Alberta Oil Peon at April 24, 2015 09:50 PM (wfUWX)

685 No, we said he is a cereal rapist.

Posted by: Snap, Crackle & Pop
****

You know you wanted it.

Posted by: Cereal Rapist at April 24, 2015 09:51 PM (F0Cog)

686 My new gender will be ynthylmygnwhypwnyshmynghys and ynthylmygnwhypwnyshmynghyself. I demand that all gender activists use it when addressing me. Failure to do so is oppressing me for my identity.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:51 PM (3HxZe)

687 Sometimes you can make the stupid choke on itself by taking it to the extremes.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:52 PM (3HxZe)

688 Sorry cato tl:dr.

Posted by: eleven at April 24, 2015 09:52 PM (MDgS8)

689 So, is meatball jr home yet?

Posted by: Bruce J. at April 24, 2015 09:53 PM (iQIUe)

690 Millions of genders. 4 races. Not even an "other" box on most forms.

--
White
Black
Asian
Native Americsn or Pacific Islander

Unrelated to any of the above, Hispanic Y/N

Posted by: @votermom at April 24, 2015 09:54 PM (cbfNE)

691 Are they disposing their eunuch horns?

Posted by: seamrog at April 24, 2015 09:54 PM (Lo0IM)

692 Stern Play.

Posted by: Garrett at April 24, 2015 09:54 PM (9cwxE)

693 Sometimes you can make the stupid choke on itself by taking it to the extremes.
Posted by: Cato
-------------------
Ha! A lot you know.

Posted by: Sheila Jackson Lee at April 24, 2015 09:54 PM (F2IAQ)

694 686 My new gender will be ynthylmygnwhypwnyshmynghys and ynthylmygnwhypwnyshmynghyself. I demand that all gender activists use it when addressing me. Failure to do so is oppressing me for my identity.

Welsh, right?

Posted by: Splunge at April 24, 2015 09:54 PM (qyomX)

695 He sure seemed to love pussy, so is he a lesbian now?

Posted by: Ima Trolle at April 24, 2015 09:19 PM (W275d)


This is why guys shouldn't joke about being a "lesbian trapped in a man's body"... such things really do exist according tot he LGBTQ&c. crowd...

Posted by: The Non-Lesbian Hat at April 24, 2015 09:55 PM (0Ew3K)

696 If this shit is okay, how come they wont chop off limbs for people? I remember when that was a thing about 10 years ago.

Posted by: Bruce J. at April 24, 2015 09:55 PM (iQIUe)

697 Cha-ching. Wow, just, wow.

Emma's parents must be loving this. Their special snowflake is actually not a victim, but, rather, the epitome of the woman scorned. At least every other male in the world has been warned now to stay away.

Posted by: Ever at April 24, 2015 09:55 PM (hRV3r)

698 I am a hypersex gender that requires frequent sex with females who rate no less than a 9. If the government cannot accommodate me I deserve SSDI.

Posted by: Cruzinator at April 24, 2015 09:56 PM (P7ulB)

699 Gender is fluid but your race determines your destiny.

- Party of "science"
Posted by: @votermom at April 24, 2015 09:47 PM (cbfNE)

Millions of genders. 4 races. Not even an "other" box on most forms.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:49 PM (3HxZe)


Don't forget about "other-kin"!

Posted by: The Hat-kin at April 24, 2015 09:56 PM (0Ew3K)

700 So whats next?

The nay sayers on gay marriage were right. this is leading to the normalization of transvestites. Plural marriage TV shows are on TV... that'll be a forgone thing soon. What's the next big progressive move we as a society have to make?

Posted by: mynewhandle at April 24, 2015 09:56 PM (AkOaV)

701 >>685 No, we said he is a cereal rapist.



The Cookie Crook Strikes Again.

Posted by: Garrett at April 24, 2015 09:56 PM (9cwxE)

702 Undermine biological certainties, you undermine society.

/Frankfurt School 101

Posted by: Pappy O'Daniel at April 24, 2015 09:56 PM (jOumW)

703 There are a bunch of STDs that can eventually lead to cancer. I hope she gets a colonoscopy soon.

Posted by: @votermom at April 24, 2015 08:13 PM (cbfNE)


She won't need a colonoscopy. They'll just get a chimp to shove an iPhone up there and take pics, now that the bottleneck has been alleviated.

Posted by: Alberta Oil Peon at April 24, 2015 09:57 PM (wfUWX)

704 Captain Crunch is next

Posted by: Cereal Rapist at April 24, 2015 09:57 PM (F0Cog)

705 I am a hypersex gender that requires frequent sex with females who rate no less than a 9. If the government cannot accommodate me I deserve SSDI.
Posted by: Cruzinator at April 24, 2015 09:56 PM (P7ulB)

******

$2,600 or so a month only gets ya 2 or 3 nine plus encounters a month. I think. A friend told me that. Or something.

Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 09:58 PM (3F6F8)

706 700 So whats next?

The nay sayers on gay marriage were right. this is leading to the normalization of transvestites. Plural marriage TV shows are on TV... that'll be a forgone thing soon. What's the next big progressive move we as a society have to make?


Oh, please, let it be foot fetishists.

Posted by: Dick Morris at April 24, 2015 09:58 PM (qyomX)

707 No, we said he is a cereal rapist.



Posted by: Snap, Crackle Pop

****



You know you wanted it.

You guys get sloppy seconds.

Posted by: Capt'n Crunch at April 24, 2015 09:58 PM (ahBY0)

708 703 chimp- h8ter

Posted by: @votermom at April 24, 2015 09:58 PM (cbfNE)

709 This whole mess is so unjust. I hope he sues the be-jesus out of Columbia.

Posted by: Mistress Overdone at April 24, 2015 09:58 PM (2/oBD)

710 Welsh, right?
Posted by: Splunge at April 24, 2015 09:54 PM (qyomX)

For the hell of it faux-Welsh. If we're going to go with the "punish them by embracing it in ways they never expected" model, that's how you do it.

Posted by: Cato the Rebel Without a Party at April 24, 2015 09:58 PM (3HxZe)

711 yeah, this emma girl sounds like a world class whore from the guys legal complaint.

Banging loads of dudes, drunk, no condom. got the clap in a night when she banged two different dudes (unprotected) at a party. Sounds like a real winner. No wonder this german kid didn't want to date her and just wanted the butt sechs.

Posted by: mynewhandle at April 24, 2015 09:59 PM (AkOaV)

712 What's the next big progressive move we as a society have to make?
Posted by: mynewhandle at April 24, 2015 09:56 PM (AkOaV)

******

Age of consent. Take it to the Bank. Because Islam.

Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 10:00 PM (3F6F8)

713
I could make a joke about Cap'n Crunch make the roof of your dick sore.

But I would never do that.

Posted by: eleven at April 24, 2015 10:00 PM (MDgS8)

714 >>685 No, we said he is a cereal rapist.

The Cookie Crook Strikes Again.

Posted by: Garrett at April 24, 2015 09:56 PM (9cwxE)


A little mood music:

https://www.youtube.com/watch?v=ySXrmvfBNGw

Posted by: Toucan, Son of Sam at April 24, 2015 10:00 PM (0Ew3K)

715 Oh, please, let it be foot fetishists.
Posted by: Dick Morris at April 24, 2015 09:58 PM (qyomX)

It'll be cannibals.

Posted by: Cato the Rebel Without a Party at April 24, 2015 10:00 PM (3HxZe)

716 Age of consent. Next fight. Definitely.

Posted by: NCKate at April 24, 2015 10:01 PM (TDMVi)

717 North by northwest on tcm

Posted by: ThunderB at April 24, 2015 10:01 PM (zOTsN)

718 Cereal rapist? But, I'm cereal! Wait, or, am I serial? WTF?

Posted by: Manbearpig at April 24, 2015 10:01 PM (qW9du)

719 You know you wanted it.

You guys get sloppy seconds.


Posted by: Capt'n Crunch at April 24, 2015 09:58 PM (ahBY0)


*picks up mattress*

Posted by: Frankenberry at April 24, 2015 10:01 PM (yxw0r)

720 yeah, this emma girl sounds like a world class whore from the guys legal complaint.

Banging loads of dudes, drunk, no condom. got the clap in a night when she banged two different dudes (unprotected) at a party. Sounds like a real winner. No wonder this german kid didn't want to date her and just wanted the butt sechs.

Posted by: mynewhandle
****

Damned amateurs.

Posted by: Sandra Fluke at April 24, 2015 10:02 PM (F0Cog)

721 There is a darned good movie which consists entirely of one guy in a car, the whole time, affecting a Welsh accent. I think he was in Inception. Liked it a lot. Can't remember the name.

Posted by: Splunge at April 24, 2015 10:02 PM (qyomX)

722 Be glad it ain't me kid.

Posted by: Tony The Tiger at April 24, 2015 10:03 PM (ahBY0)

723 Cereal rapist? But, I'm cereal! Wait, or, am I serial? WTF?


Posted by: Manbearpig
****
You have a pretty mouth.

Posted by: Cereal Rapist at April 24, 2015 10:03 PM (F0Cog)

724 Steve Sailer has written some on the phenomenon of ultra-competitive dudes who get sex changes late in life. Jenner has 6 kids by 3 women. Olympic champ. Dude was a stud.

The late-life macho, competitive dudes seem to be hyper-narcissists.

Posted by: Costanza Defense at April 24, 2015 10:03 PM (ZPrif)

725 Posted by: Capt'n Crunch at April 24, 2015 09:58 PM (ahBY0)


OMG, like, why does the roof of my mouth hurt so much when I give you beejers?

Posted by: Coed at April 24, 2015 10:04 PM (IF3/u)

726 *picks up mattress*


Posted by: Frankenberry
****
That's it, just a little further into that poorly lit area...

Posted by: Cereal Rapist at April 24, 2015 10:04 PM (F0Cog)

727 I think there was a navy seal guy who transitioned to a ginormous ugly chick.

Posted by: NCKate at April 24, 2015 10:05 PM (TDMVi)

728 Falling Skies was always going to be shite.

The First Massachusetts? Really? New England would be first to welcome alien overlords if the overlords promised to analprobe hillbillies and murder northeast conservatives

And the fact that Spielberg produced it.... yeah. Shite.

Posted by: boulder terlit hobo at April 24, 2015 10:06 PM (E5hbC)

729 724 The late-life macho, competitive dudes seem to be hyper-narcissists.
Posted by: Costanza Defense at April 24, 2015 10:03 PM


I can follow that path. But how do you get from there to "gee, I'd sure like to have my genitals chopped off?"

Posted by: Splunge at April 24, 2015 10:06 PM (qyomX)

730 There is a darned good movie which consists entirely of one guy in a car, the whole time, affecting a Welsh accent. I think he was in Inception. Liked it a lot. Can't remember the name.
Posted by: Splunge


Lock, with Tom Hardy, played Bain in the last Batman and plays the next Mad Max.

It's pretty good for a Euro-art flick.

Posted by: weft cut-loop at April 24, 2015 10:07 PM (KhFZp)

731 University of Michigan(yes, I'm a Buckeye, but that shouldn't matter)actually has a day in which a group of unhappy mentally ill female students carry mattresses around to protest campus rape.

So you see these twin mattresses lying around all over campus and wonder if it's a special student move in day, or what the hell is going on. Their dopey protest is lost on all but those who unfortunately, didn't turn off the local news and were informed what the mattresses represent.

Posted by: Jen the original at April 24, 2015 10:07 PM (PfWwQ)

732 I think there was a navy seal guy who transitioned to a ginormous ugly chick.
Posted by: NCKate at April 24, 2015 10:05 PM (TDMVi)

*****

I used to work with one who was about 6'3", 230 or so, Adams Apple and hairy knuckles. Went by the name Sharon.

Good times....

Posted by: ManWithNoParty, unperson from Free Market Jesus Paradise at April 24, 2015 10:08 PM (cIoI4)

733 So let's say they really feel like they were born in the wrong body. And they want it corrected. Like fixing a cleft palate. Bad analogy but ok. They need surgery to correct something. Fine. Why the announcements. The demand for attention and approval. Why not just do it, quietly. I know that would be impossible for Jenner. But what about the others. What about this condition requires an audience

Posted by: ThunderB at April 24, 2015 10:08 PM (zOTsN)

734 ONT

Posted by: The Political Hat at April 24, 2015 10:08 PM (0Ew3K)

735 >>>>>If being a man, and thinking you're a woman is not a delusion, then I think it's time to just put the DSM into the shredder.
Posted by: LawLurker at April 24, 2015 09:43 PM (zKwtX)
-----
At my work's diversity training (anti-bullying, with special message from the Bully-in-Chief), we were taught that we should tell transgenders they should be proud of who they are.

Posted by: Mindy at April 24, 2015 10:09 PM (OYnFN)

736 729 724 The late-life macho, competitive dudes seem to be hyper-narcissists.
Posted by: Costanza Defense at April 24, 2015 10:03 PM

I can follow that path. But how do you get from there to "gee, I'd sure like to have my genitals chopped off?"
Posted by: Splunge at April 24, 2015 10:06 PM (qyomX)

Because late in life when they're not stronger or faster than anyone else, their self-worth tanks and they are easy prey for cult-type tactics.

Posted by: Cato the Rebel Without a Party at April 24, 2015 10:09 PM (3HxZe)

737 Jeebeers..., I thought people were kidding..., both her parents are psychiatrists.

Posted by: Mike Hammer, etc., etc. at April 24, 2015 08:54 PM (F2IAQ)


So the cray-cray, she comes by it honestly.

Posted by: Alberta Oil Peon at April 24, 2015 10:09 PM (wfUWX)

738 Err, 'Locke,' rather.

Posted by: weft cut-loop at April 24, 2015 10:09 PM (KhFZp)

739 Steve Sailer has written some on the phenomenon of ultra-competitive dudes who get sex changes late in life. Jenner has 6 kids by 3 women. Olympic champ. Dude was a stud.

The late-life macho, competitive dudes seem to be hyper-narcissists.
Posted by: Costanza Defense at April 24, 2015 10:03 PM (ZPrif)

Jenner gets no credit for having two kids with Kris Kardashian. Seriously, who wouldn't she bang and get knocked up by if she thought it would bring cameras and money. She and her slime bag older daughters will do anyone at anytime, including marry them for a contract extension with E! network.

Posted by: Jen the original at April 24, 2015 10:10 PM (PfWwQ)

740 What about this condition requires an audience
Posted by: ThunderB at April 24, 2015 10:08 PM (zOTsN)

It's a religion (even if a cultish one), and to them, this is a sacrament.

Posted by: Cato the Rebel Without a Party at April 24, 2015 10:10 PM (3HxZe)

741 She and her slime bag older daughters will do anyone at anytime, including marry them for a contract extension with E! network.
Posted by: Jen the original at April 24, 2015 10:10 PM (PfWwQ)

******

I have no idea what yous talkin bout.

Posted by: Kanye at April 24, 2015 10:12 PM (cIoI4)

742 I have only met two transsexuals and BOTH had metal plates on their skulls from head injuries. They were family members of friends or work associates.

Posted by: Lester at April 24, 2015 10:13 PM (2UPXV)

743 Remember Renee Richards? They let him play on the Women's Professional Tennis circuit , WTA. PC has been around a long time now.

By the way he proved you could play tennis without balls.

Posted by: Cruzinator at April 24, 2015 10:14 PM (P7ulB)

744 40
Unfortunately, Gillibrand, as an elected official, can't be sued for her slanderous and defamatory remarks.


Posted by: OregonMuse at April 24, 2015 06:23 PM (I8YZX)
Maybe she needs to work out on Uncle Harry's exercise equipment. Nothing like a good beating tune-up to put your heart right with god.

Posted by: Uncle Harry's Exercise Equipment at April 24, 2015 10:20 PM (5CWXs)

745 BREAKING:

BRUCE JENNER CAME OUT AS A CONSERVATIVE REPUBLICAN

Posted by: mynewhandle at April 24, 2015 10:29 PM (AkOaV)

746 DIANE SAWYER QUESTIONS IF HE WILL LOBBY MITCH AND BOEHNER FOR TRANS RIGHTS

Posted by: mynewhandle at April 24, 2015 10:30 PM (AkOaV)

747 Anybody else remember when Jenner's first wife (back in the 70s) came home from their honeymoon with a broken rib? Lots of snickering over the wild sex they must have had, but maybe she just caught him trying on her negligee!

Posted by: stinkylegs at April 24, 2015 10:35 PM (s3xUJ)

748 727 I think there was a navy seal guy who transitioned to a ginormous ugly chick.

Posted by: NCKate at April 24, 2015 10:05 PM (TDMVi)

**************************

That be Kirstin Beck, who wrote the book Warrior Princess.

Let me clarify some of the confusion here: there are basically 2 types of male to female transsexuals:

HT (homosexual transsexuals): these transition early, are exclusively attracted to men, and are often relatively convincing. Think Janet Mock.


AT (autogynephilic transsexuals): these transition late, are attracted to women, and are grotesquely unconvincing. Guess which classification Bruce falls under?


HTs transition because they feel guilty about their homosexual desires. ATs transition because they are aroused by the thought of becoming female. This is called erotic target location error (ETLE): instead of focussing on another person of the opposite gender as the proper object of erotic love, they focus on... themselves.

Posted by: Bruce Jenner at April 24, 2015 10:39 PM (XrHO0)

749 Nauseating. Quick read, but I couldn't get through it.

Posted by: bcorig at April 24, 2015 10:59 PM (eLuP6)

750 "...instead of focussing on another person of the opposite gender as the proper object of erotic love, they focus on... themselves."

That is not at all hard to believe in Jenner's case.

Posted by: Ace's liver at April 25, 2015 03:20 AM (+azJs)

751 I'm so pissed off about this Columbia shit after reading that stuff (and all the footnoted links, with the asinine comments!) that immabout ready to fucking RIOT. Burn it down, make this guy rich off Columbia University's ashes.
But not Emma. Make her live her life knowing she's a destructive, abusive liar - just like a fucking rapist.

Sorry for being so sweary but I AM PISSED.

(Don't care much about batshit crazy Jenner except I kinda feel sorry for him because he is completely nuts)

Posted by: Beth at April 25, 2015 03:43 AM (Epq7Y)

Posted by: Vic We Have No Party at April 25, 2015 05:10 AM (wlDny)

753
Modern kids live messy lives.

Leads to trouble.

Posted by: Lily at April 25, 2015 10:19 AM (dXCcK)

754 I am not lopsided the mattress is.

Posted by: Emma's Lopsided Ass at April 25, 2015 12:24 PM (5x+vK)

755 When he is done, the University will be renamed Nungesser University. The clowns at Columbia know better, and chose to make this process a clownshow.

Sue the holy living f**k out of them. Make them hurt. Make them pay.

Posted by: Joe at April 25, 2015 02:22 PM (/WaV2)

756 "The Triple-Breasted Whore of Eroticon Six"

Cons, amirite? I think I met her. Brunette?

Posted by: HAL at April 25, 2015 05:28 PM (OmBeX)

757 The mattress chick is not a party in the suit. Colombia University, it's President, it's Board of Trustees, and the professor who is the mattress chick's advisor are the defendants. I hope the plaintiff wins the suit or the defendants settle with at least a private admission of wrongdoing.

The mattress chick needs to face the consequences, too, but that won't happen as part of this suit.

Posted by: Another lurking lurker what lurks at April 26, 2015 04:49 PM (WTwmr)

(Jump to top of page)






Processing 0.09, elapsed 0.0923 seconds.
15 queries taking 0.0306 seconds, 766 records returned.
Page size 320 kb.
Powered by Minx 0.8 beta.



MuNuvians
MeeNuvians
Polls! Polls! Polls!

Real Clear Politics
Gallup
Frequently Asked Questions
The (Almost) Complete Paul Anka Integrity Kick
Top Top Tens
Greatest Hitjobs

The Ace of Spades HQ Sex-for-Money Skankathon
A D&D Guide to the Democratic Candidates
Margaret Cho: Just Not Funny
More Margaret Cho Abuse
Margaret Cho: Still Not Funny
Iraqi Prisoner Claims He Was Raped... By Woman
Wonkette Announces "Morning Zoo" Format
John Kerry's "Plan" Causes Surrender of Moqtada al-Sadr's Militia
World Muslim Leaders Apologize for Nick Berg's Beheading
Michael Moore Goes on Lunchtime Manhattan Death-Spree
Milestone: Oliver Willis Posts 400th "Fake News Article" Referencing Britney Spears
Liberal Economists Rue a "New Decade of Greed"
Artificial Insouciance: Maureen Dowd's Word Processor Revolts Against Her Numbing Imbecility
Intelligence Officials Eye Blogs for Tips
They Done Found Us Out, Cletus: Intrepid Internet Detective Figures Out Our Master Plan
Shock: Josh Marshall Almost Mentions Sarin Discovery in Iraq
Leather-Clad Biker Freaks Terrorize Australian Town
When Clinton Was President, Torture Was Cool
What Wonkette Means When She Explains What Tina Brown Means
Wonkette's Stand-Up Act
Wankette HQ Gay-Rumors Du Jour
Here's What's Bugging Me: Goose and Slider
My Own Micah Wright Style Confession of Dishonesty
Outraged "Conservatives" React to the FMA
An On-Line Impression of Dennis Miller Having Sex with a Kodiak Bear
The Story the Rightwing Media Refuses to Report!
Our Lunch with David "Glengarry Glen Ross" Mamet
The House of Love: Paul Krugman
A Michael Moore Mystery (TM)
The Dowd-O-Matic!
Liberal Consistency and Other Myths
Kepler's Laws of Liberal Media Bias
John Kerry-- The Splunge! Candidate
"Divisive" Politics & "Attacks on Patriotism" (very long)
The Donkey ("The Raven" parody)
News/Chat